Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R881

Protein Details
Accession F4R881    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-37AYFSRFQVKYRRRREGKTDYYARKRLIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5cyto_mito 9.5, nucl 9, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005485  Rbsml_L5_euk/L18_arc  
IPR025607  Rbsml_L5e_C  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0008097  F:5S rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0000027  P:ribosomal large subunit assembly  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_41926  -  
Pfam View protein in Pfam  
PF14204  Ribosomal_L18_c  
PF17144  Ribosomal_L5e  
CDD cd00432  Ribosomal_L18_L5e  
Amino Acid Sequences MPFVKLVKNSAYFSRFQVKYRRRREGKTDYYARKRLITQAKNKYNSPKYRLVVRITNRDIICQIVHAKLQGDFVLAAAYSHELPRYGIKHGLTNWAAAYATGLLVARRALTKLGLADKYAGVEEPEGDLVLTEANEDGPRPFKAFLDVGLRRTSTGARVFGAMKGASDGGIFVPHSENRFPGFDPEAKELDADVLKSYIYSGHVAEYMEALEEEDDERFKKQFASYLADDIGSGDIEEIYTEAHKAIRADPSAQPTDKSKLEEYKKASKANKFTKIGKEQRAENVKAKVAEYLKNSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.43
4 0.51
5 0.54
6 0.61
7 0.7
8 0.76
9 0.74
10 0.8
11 0.85
12 0.85
13 0.84
14 0.84
15 0.84
16 0.83
17 0.85
18 0.84
19 0.76
20 0.69
21 0.62
22 0.61
23 0.62
24 0.61
25 0.61
26 0.66
27 0.73
28 0.73
29 0.75
30 0.76
31 0.75
32 0.75
33 0.72
34 0.7
35 0.63
36 0.68
37 0.69
38 0.64
39 0.63
40 0.61
41 0.64
42 0.58
43 0.63
44 0.54
45 0.49
46 0.44
47 0.37
48 0.3
49 0.23
50 0.22
51 0.16
52 0.17
53 0.16
54 0.17
55 0.16
56 0.17
57 0.14
58 0.13
59 0.1
60 0.1
61 0.09
62 0.07
63 0.06
64 0.06
65 0.07
66 0.06
67 0.07
68 0.07
69 0.07
70 0.08
71 0.13
72 0.15
73 0.16
74 0.19
75 0.2
76 0.23
77 0.24
78 0.3
79 0.26
80 0.25
81 0.23
82 0.19
83 0.18
84 0.14
85 0.14
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.07
97 0.07
98 0.08
99 0.1
100 0.14
101 0.14
102 0.14
103 0.14
104 0.14
105 0.14
106 0.13
107 0.11
108 0.07
109 0.06
110 0.06
111 0.06
112 0.06
113 0.05
114 0.05
115 0.04
116 0.04
117 0.04
118 0.03
119 0.03
120 0.03
121 0.03
122 0.04
123 0.04
124 0.05
125 0.07
126 0.07
127 0.09
128 0.1
129 0.09
130 0.12
131 0.12
132 0.13
133 0.2
134 0.2
135 0.21
136 0.21
137 0.21
138 0.19
139 0.2
140 0.18
141 0.13
142 0.15
143 0.14
144 0.13
145 0.14
146 0.15
147 0.14
148 0.16
149 0.12
150 0.09
151 0.08
152 0.08
153 0.07
154 0.06
155 0.06
156 0.04
157 0.05
158 0.05
159 0.05
160 0.07
161 0.08
162 0.1
163 0.11
164 0.12
165 0.13
166 0.15
167 0.14
168 0.15
169 0.18
170 0.19
171 0.22
172 0.24
173 0.23
174 0.22
175 0.21
176 0.18
177 0.17
178 0.14
179 0.11
180 0.08
181 0.07
182 0.07
183 0.07
184 0.07
185 0.06
186 0.07
187 0.08
188 0.08
189 0.08
190 0.1
191 0.1
192 0.1
193 0.09
194 0.08
195 0.07
196 0.06
197 0.06
198 0.04
199 0.05
200 0.05
201 0.06
202 0.07
203 0.07
204 0.09
205 0.09
206 0.1
207 0.12
208 0.13
209 0.18
210 0.2
211 0.26
212 0.26
213 0.28
214 0.28
215 0.25
216 0.24
217 0.2
218 0.16
219 0.09
220 0.08
221 0.05
222 0.05
223 0.05
224 0.05
225 0.04
226 0.04
227 0.05
228 0.05
229 0.06
230 0.07
231 0.09
232 0.1
233 0.13
234 0.18
235 0.2
236 0.24
237 0.27
238 0.33
239 0.37
240 0.36
241 0.36
242 0.34
243 0.38
244 0.37
245 0.38
246 0.36
247 0.4
248 0.46
249 0.52
250 0.55
251 0.59
252 0.63
253 0.67
254 0.69
255 0.68
256 0.72
257 0.74
258 0.77
259 0.73
260 0.74
261 0.75
262 0.78
263 0.79
264 0.78
265 0.73
266 0.69
267 0.73
268 0.74
269 0.69
270 0.65
271 0.62
272 0.57
273 0.54
274 0.49
275 0.46
276 0.42
277 0.42