Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R8BIK9

Protein Details
Accession R8BIK9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSLPPKKQSKSRKRYSLGATSEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 6
Family & Domain DBs
KEGG tmn:UCRPA7_5438  -  
Amino Acid Sequences MSLPPKKQSKSRKRYSLGATSEAAHNHPQEEPRGRYVHSRDKHVIEMERRLRRLERDGNAWLGAMMPLLNNLNQTLGKLQDEEDYELSRKEWGDGYRDIPELESFRARPTYQYQHQEQEEEDEFTRPTRRPHTADPNRHRRLSMQSDFEPRGRSLRSRSRQSQASRQSWAGGPPPMASMSSSRDRGRRISPYKMPLHEEPEEPSWHQRDERRRTVGQAPRDLSEFRRSAAGFRSRSRSSSGSGESMVLGGGGLDNLEPLMRELMGGSRLDQQTPGDRRTPLEDDPEAVFAMF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.82
4 0.75
5 0.69
6 0.59
7 0.5
8 0.48
9 0.4
10 0.35
11 0.29
12 0.25
13 0.22
14 0.24
15 0.25
16 0.3
17 0.37
18 0.39
19 0.4
20 0.42
21 0.42
22 0.47
23 0.52
24 0.55
25 0.51
26 0.55
27 0.55
28 0.56
29 0.59
30 0.55
31 0.55
32 0.5
33 0.55
34 0.56
35 0.58
36 0.56
37 0.56
38 0.54
39 0.52
40 0.56
41 0.54
42 0.5
43 0.48
44 0.49
45 0.48
46 0.44
47 0.38
48 0.29
49 0.2
50 0.16
51 0.1
52 0.07
53 0.05
54 0.06
55 0.07
56 0.07
57 0.07
58 0.07
59 0.09
60 0.09
61 0.1
62 0.1
63 0.11
64 0.12
65 0.12
66 0.12
67 0.14
68 0.16
69 0.18
70 0.18
71 0.18
72 0.18
73 0.18
74 0.17
75 0.16
76 0.14
77 0.13
78 0.15
79 0.15
80 0.19
81 0.2
82 0.23
83 0.24
84 0.24
85 0.23
86 0.19
87 0.19
88 0.16
89 0.16
90 0.16
91 0.14
92 0.15
93 0.18
94 0.17
95 0.19
96 0.23
97 0.3
98 0.34
99 0.4
100 0.42
101 0.45
102 0.45
103 0.43
104 0.37
105 0.34
106 0.28
107 0.24
108 0.21
109 0.16
110 0.15
111 0.16
112 0.19
113 0.16
114 0.19
115 0.22
116 0.27
117 0.31
118 0.38
119 0.48
120 0.54
121 0.64
122 0.69
123 0.74
124 0.74
125 0.7
126 0.63
127 0.54
128 0.52
129 0.5
130 0.45
131 0.39
132 0.37
133 0.41
134 0.42
135 0.41
136 0.35
137 0.26
138 0.25
139 0.22
140 0.22
141 0.24
142 0.33
143 0.39
144 0.45
145 0.5
146 0.52
147 0.58
148 0.6
149 0.62
150 0.61
151 0.57
152 0.52
153 0.47
154 0.43
155 0.37
156 0.34
157 0.28
158 0.2
159 0.17
160 0.14
161 0.14
162 0.13
163 0.12
164 0.11
165 0.1
166 0.13
167 0.17
168 0.2
169 0.22
170 0.25
171 0.27
172 0.31
173 0.34
174 0.4
175 0.41
176 0.46
177 0.5
178 0.55
179 0.58
180 0.57
181 0.57
182 0.49
183 0.5
184 0.44
185 0.39
186 0.34
187 0.31
188 0.31
189 0.27
190 0.29
191 0.25
192 0.25
193 0.28
194 0.32
195 0.39
196 0.46
197 0.53
198 0.55
199 0.54
200 0.57
201 0.62
202 0.63
203 0.6
204 0.58
205 0.52
206 0.46
207 0.47
208 0.44
209 0.38
210 0.38
211 0.32
212 0.24
213 0.27
214 0.26
215 0.26
216 0.33
217 0.38
218 0.34
219 0.38
220 0.45
221 0.42
222 0.44
223 0.46
224 0.41
225 0.36
226 0.38
227 0.36
228 0.31
229 0.3
230 0.28
231 0.23
232 0.21
233 0.17
234 0.1
235 0.07
236 0.05
237 0.04
238 0.03
239 0.03
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.05
246 0.06
247 0.06
248 0.06
249 0.07
250 0.1
251 0.12
252 0.12
253 0.13
254 0.2
255 0.22
256 0.22
257 0.23
258 0.24
259 0.31
260 0.36
261 0.39
262 0.35
263 0.36
264 0.38
265 0.43
266 0.46
267 0.39
268 0.41
269 0.38
270 0.36
271 0.36
272 0.35