Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BPH8

Protein Details
Accession R8BPH8   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MPKKRKNKFVHGRNKKGRGHVKPIRCSNCBasic
84-114GKIVRVRSREGRRNRAPPPRVRYNKDGKKVTBasic
NLS Segment(s)
PositionSequence
3-22KKRKNKFVHGRNKKGRGHVK
88-112RVRSREGRRNRAPPPRVRYNKDGKK
Subcellular Location(s) mito 12, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG tmn:UCRPA7_3241  -  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MPKKRKNKFVHGRNKKGRGHVKPIRCSNCSRCTPKDKAIKRFTIRNMVESAAIRDISDASVFAEYTVPKMYLKLQYCVSCAIHGKIVRVRSREGRRNRAPPPRVRYNKDGKKVTPTQGAKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.86
3 0.86
4 0.85
5 0.82
6 0.81
7 0.79
8 0.78
9 0.78
10 0.83
11 0.79
12 0.72
13 0.71
14 0.68
15 0.69
16 0.68
17 0.65
18 0.62
19 0.64
20 0.67
21 0.68
22 0.71
23 0.7
24 0.71
25 0.72
26 0.74
27 0.7
28 0.71
29 0.66
30 0.66
31 0.59
32 0.51
33 0.44
34 0.36
35 0.33
36 0.26
37 0.24
38 0.14
39 0.14
40 0.11
41 0.09
42 0.09
43 0.07
44 0.07
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.05
52 0.06
53 0.07
54 0.07
55 0.07
56 0.08
57 0.11
58 0.17
59 0.19
60 0.21
61 0.23
62 0.24
63 0.25
64 0.28
65 0.25
66 0.2
67 0.2
68 0.19
69 0.2
70 0.2
71 0.22
72 0.23
73 0.29
74 0.32
75 0.32
76 0.36
77 0.41
78 0.5
79 0.56
80 0.62
81 0.66
82 0.7
83 0.76
84 0.81
85 0.82
86 0.8
87 0.81
88 0.8
89 0.81
90 0.81
91 0.79
92 0.79
93 0.79
94 0.81
95 0.81
96 0.8
97 0.72
98 0.72
99 0.73
100 0.7
101 0.7
102 0.63