Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BRX1

Protein Details
Accession R8BRX1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
157-188SKYNDEGKEDKKKPRSKSRSRNIFGRKSRANTHydrophilic
NLS Segment(s)
PositionSequence
164-185KEDKKKPRSKSRSRNIFGRKSR
Subcellular Location(s) mito 10.5, cyto_mito 9.5, nucl 9, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006597  Sel1-like  
IPR011990  TPR-like_helical_dom_sf  
KEGG tmn:UCRPA7_2380  -  
Pfam View protein in Pfam  
PF08238  Sel1  
Amino Acid Sequences MSDIPAEEHVSKAIALHEAACRHGWGMRPNQREGVEWLRKAAECASVEIAEDEDHVKEGKAVDFLERKTRKAQFALSIYELGVSHMNGWGIEQDKALALRCFEIAGNWGDVDALAEAGFCYAQGIGCKKNLKTSAKFYRMAEAKGMSMVGNSWIHKSKYNDEGKEDKKKPRSKSRSRNIFGRKSRANTAASS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.16
5 0.16
6 0.18
7 0.18
8 0.17
9 0.16
10 0.18
11 0.21
12 0.24
13 0.34
14 0.41
15 0.45
16 0.47
17 0.52
18 0.51
19 0.48
20 0.48
21 0.47
22 0.45
23 0.41
24 0.4
25 0.37
26 0.36
27 0.35
28 0.3
29 0.25
30 0.19
31 0.2
32 0.21
33 0.18
34 0.18
35 0.17
36 0.16
37 0.1
38 0.1
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.08
45 0.09
46 0.09
47 0.1
48 0.1
49 0.14
50 0.17
51 0.18
52 0.28
53 0.28
54 0.29
55 0.35
56 0.39
57 0.38
58 0.37
59 0.39
60 0.35
61 0.36
62 0.37
63 0.31
64 0.27
65 0.23
66 0.21
67 0.18
68 0.13
69 0.1
70 0.07
71 0.06
72 0.06
73 0.07
74 0.06
75 0.06
76 0.06
77 0.07
78 0.07
79 0.07
80 0.06
81 0.07
82 0.07
83 0.09
84 0.08
85 0.07
86 0.07
87 0.07
88 0.07
89 0.07
90 0.06
91 0.07
92 0.08
93 0.08
94 0.07
95 0.07
96 0.06
97 0.06
98 0.06
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.02
107 0.03
108 0.03
109 0.04
110 0.06
111 0.09
112 0.11
113 0.15
114 0.2
115 0.2
116 0.27
117 0.34
118 0.38
119 0.41
120 0.49
121 0.55
122 0.57
123 0.6
124 0.54
125 0.55
126 0.51
127 0.48
128 0.41
129 0.31
130 0.26
131 0.23
132 0.22
133 0.14
134 0.11
135 0.1
136 0.1
137 0.12
138 0.12
139 0.15
140 0.2
141 0.21
142 0.27
143 0.32
144 0.34
145 0.42
146 0.5
147 0.49
148 0.5
149 0.58
150 0.6
151 0.67
152 0.68
153 0.68
154 0.69
155 0.74
156 0.78
157 0.8
158 0.83
159 0.84
160 0.88
161 0.9
162 0.91
163 0.89
164 0.89
165 0.88
166 0.87
167 0.84
168 0.83
169 0.8
170 0.75
171 0.76
172 0.72