Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BSC4

Protein Details
Accession R8BSC4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-35LNNLKSKFKAIFKKKSEKKPEAAKPTEHydrophilic
NLS Segment(s)
PositionSequence
15-33KFKAIFKKKSEKKPEAAKP
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
KEGG tmn:UCRPA7_2314  -  
Amino Acid Sequences MPGVPPDALNNLKSKFKAIFKKKSEKKPEAAKPTEAAKPEETPAAPAEPTKTETAPAAAPATDAAAAPVEAPKTEETPAAPAPEPTPAADAAAAPAPVAEEPKPAEAPKAEEPAPVPAATTDAAAAPAPTEATPAPTEEPKKEEAPAPAPAAAPAAPTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.4
4 0.49
5 0.53
6 0.61
7 0.65
8 0.76
9 0.81
10 0.86
11 0.88
12 0.85
13 0.84
14 0.84
15 0.84
16 0.83
17 0.78
18 0.7
19 0.63
20 0.59
21 0.55
22 0.47
23 0.4
24 0.33
25 0.3
26 0.28
27 0.28
28 0.24
29 0.21
30 0.2
31 0.18
32 0.15
33 0.14
34 0.15
35 0.14
36 0.16
37 0.16
38 0.15
39 0.14
40 0.14
41 0.15
42 0.13
43 0.13
44 0.11
45 0.09
46 0.09
47 0.08
48 0.08
49 0.06
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.05
56 0.05
57 0.05
58 0.06
59 0.07
60 0.08
61 0.09
62 0.09
63 0.08
64 0.11
65 0.12
66 0.13
67 0.12
68 0.11
69 0.11
70 0.12
71 0.13
72 0.1
73 0.1
74 0.08
75 0.08
76 0.08
77 0.07
78 0.06
79 0.07
80 0.06
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.06
87 0.07
88 0.08
89 0.1
90 0.12
91 0.12
92 0.14
93 0.13
94 0.18
95 0.21
96 0.24
97 0.22
98 0.22
99 0.23
100 0.25
101 0.25
102 0.2
103 0.16
104 0.12
105 0.13
106 0.12
107 0.11
108 0.08
109 0.06
110 0.07
111 0.07
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.08
118 0.07
119 0.1
120 0.11
121 0.13
122 0.16
123 0.21
124 0.25
125 0.27
126 0.3
127 0.31
128 0.32
129 0.33
130 0.34
131 0.34
132 0.34
133 0.36
134 0.35
135 0.32
136 0.31
137 0.29
138 0.26
139 0.2