Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RV02

Protein Details
Accession F4RV02    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MLTPCRAPNQSKKNKSNRSSTHPTHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, mito 9, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008979  Galactose-bd-like_sf  
IPR045120  Suco/Slp1-like  
IPR012919  SUN_dom  
Gene Ontology GO:0016020  C:membrane  
KEGG mlr:MELLADRAFT_72518  -  
Pfam View protein in Pfam  
PF07738  Sad1_UNC  
PROSITE View protein in PROSITE  
PS51469  SUN  
Amino Acid Sequences MLTPCRAPNQSKKNKSNRSSTHPTHSDSNFVIFELGDEIEIDHVVLANYEFFSSMYKLIRITVSNSGLGGAGGIKWVEVGRFKTRNVRGIQVFPIKHLKGFYRYVRLDFLSHYGSKYFCPLSLVRIYGLTQIDAYGRDEELERRRQLELKEFEDDLQDHEKTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.87
3 0.87
4 0.84
5 0.82
6 0.81
7 0.77
8 0.76
9 0.69
10 0.67
11 0.63
12 0.56
13 0.51
14 0.42
15 0.4
16 0.3
17 0.26
18 0.22
19 0.15
20 0.14
21 0.11
22 0.1
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.06
29 0.04
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.05
36 0.05
37 0.05
38 0.05
39 0.07
40 0.07
41 0.09
42 0.1
43 0.1
44 0.1
45 0.11
46 0.13
47 0.12
48 0.14
49 0.17
50 0.18
51 0.17
52 0.17
53 0.16
54 0.14
55 0.13
56 0.1
57 0.05
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.06
66 0.1
67 0.15
68 0.18
69 0.19
70 0.27
71 0.3
72 0.36
73 0.36
74 0.38
75 0.34
76 0.34
77 0.38
78 0.36
79 0.33
80 0.29
81 0.34
82 0.29
83 0.28
84 0.27
85 0.25
86 0.23
87 0.29
88 0.3
89 0.32
90 0.33
91 0.34
92 0.35
93 0.34
94 0.3
95 0.25
96 0.24
97 0.2
98 0.19
99 0.18
100 0.17
101 0.16
102 0.16
103 0.18
104 0.16
105 0.12
106 0.15
107 0.15
108 0.19
109 0.21
110 0.22
111 0.19
112 0.19
113 0.2
114 0.2
115 0.2
116 0.16
117 0.12
118 0.12
119 0.12
120 0.12
121 0.14
122 0.11
123 0.1
124 0.11
125 0.12
126 0.18
127 0.24
128 0.31
129 0.31
130 0.32
131 0.35
132 0.39
133 0.42
134 0.46
135 0.46
136 0.42
137 0.44
138 0.43
139 0.41
140 0.4
141 0.37
142 0.31
143 0.29