Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R8BIX9

Protein Details
Accession R8BIX9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
95-114SSSSPASRHRKRPSIRRAAQHydrophilic
NLS Segment(s)
PositionSequence
102-110RHRKRPSIR
Subcellular Location(s) mito 13, nucl 9.5, cyto_nucl 6.5, cyto 2.5
Family & Domain DBs
KEGG tmn:UCRPA7_5250  -  
Amino Acid Sequences MSSSRLSPVPRSHSRASIAASVTTYHSFQDVDVYEPSTEASSPTTVNPYVDPDPPTPPLFSKDEPAPQMRRQDSGYESLTPRKSQSRRRTSSTLSSSSPASRHRKRPSIRRAAQSGPVTHLSRPGAQAISLTRSHQPHPHSSTFFHFPVPGPATRASVDGTVLVTSTALAGDLDYGYSYDDAELPPVEAPSHPTPPPQTTHYWTSDRTRRLEYAAIDAASRGVRGWVMRHMVPECFVPRERRRVGFDDDAGSVRRYRLELECEESAEKEGFGSCNGGKEKKVWWSIWKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.55
3 0.51
4 0.47
5 0.4
6 0.34
7 0.31
8 0.26
9 0.25
10 0.24
11 0.21
12 0.15
13 0.15
14 0.14
15 0.13
16 0.18
17 0.16
18 0.17
19 0.18
20 0.19
21 0.18
22 0.18
23 0.19
24 0.13
25 0.12
26 0.1
27 0.11
28 0.11
29 0.11
30 0.13
31 0.16
32 0.16
33 0.17
34 0.17
35 0.21
36 0.22
37 0.25
38 0.27
39 0.25
40 0.28
41 0.31
42 0.32
43 0.28
44 0.27
45 0.28
46 0.29
47 0.28
48 0.29
49 0.3
50 0.34
51 0.36
52 0.41
53 0.42
54 0.41
55 0.49
56 0.46
57 0.44
58 0.4
59 0.4
60 0.37
61 0.36
62 0.34
63 0.29
64 0.29
65 0.34
66 0.35
67 0.32
68 0.32
69 0.37
70 0.42
71 0.48
72 0.57
73 0.61
74 0.65
75 0.71
76 0.73
77 0.69
78 0.71
79 0.67
80 0.59
81 0.5
82 0.45
83 0.4
84 0.36
85 0.34
86 0.33
87 0.36
88 0.4
89 0.48
90 0.55
91 0.63
92 0.68
93 0.76
94 0.79
95 0.8
96 0.8
97 0.77
98 0.73
99 0.67
100 0.66
101 0.59
102 0.49
103 0.41
104 0.38
105 0.33
106 0.28
107 0.29
108 0.23
109 0.21
110 0.21
111 0.19
112 0.15
113 0.13
114 0.14
115 0.12
116 0.14
117 0.13
118 0.14
119 0.16
120 0.18
121 0.2
122 0.23
123 0.25
124 0.29
125 0.35
126 0.37
127 0.35
128 0.34
129 0.36
130 0.36
131 0.34
132 0.27
133 0.21
134 0.18
135 0.21
136 0.22
137 0.18
138 0.16
139 0.17
140 0.18
141 0.18
142 0.18
143 0.14
144 0.11
145 0.11
146 0.09
147 0.08
148 0.06
149 0.06
150 0.05
151 0.04
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.03
161 0.03
162 0.03
163 0.04
164 0.04
165 0.04
166 0.04
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.07
174 0.07
175 0.06
176 0.12
177 0.15
178 0.19
179 0.19
180 0.21
181 0.24
182 0.27
183 0.3
184 0.28
185 0.29
186 0.3
187 0.35
188 0.38
189 0.37
190 0.38
191 0.43
192 0.46
193 0.47
194 0.45
195 0.44
196 0.41
197 0.41
198 0.42
199 0.34
200 0.32
201 0.3
202 0.26
203 0.22
204 0.2
205 0.19
206 0.15
207 0.14
208 0.08
209 0.06
210 0.07
211 0.08
212 0.11
213 0.14
214 0.18
215 0.19
216 0.23
217 0.24
218 0.23
219 0.24
220 0.25
221 0.23
222 0.23
223 0.26
224 0.32
225 0.37
226 0.47
227 0.51
228 0.53
229 0.56
230 0.57
231 0.61
232 0.57
233 0.53
234 0.46
235 0.42
236 0.39
237 0.34
238 0.31
239 0.25
240 0.2
241 0.19
242 0.17
243 0.2
244 0.22
245 0.27
246 0.29
247 0.34
248 0.34
249 0.34
250 0.34
251 0.31
252 0.29
253 0.23
254 0.19
255 0.14
256 0.14
257 0.12
258 0.12
259 0.16
260 0.14
261 0.2
262 0.25
263 0.27
264 0.27
265 0.3
266 0.34
267 0.39
268 0.45
269 0.42
270 0.47