Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4REW5

Protein Details
Accession F4REW5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-28RGDLAPRKFKYRKAFKGRLPIRTGBasic
NLS Segment(s)
PositionSequence
16-17RK
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016180  Ribosomal_L10e/L16  
IPR036920  Ribosomal_L10e/L16_sf  
IPR000114  Ribosomal_L16  
IPR020798  Ribosomal_L16_CS  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG mlr:MELLADRAFT_28923  -  
Pfam View protein in Pfam  
PF00252  Ribosomal_L16  
PROSITE View protein in PROSITE  
PS00701  RIBOSOMAL_L16_2  
CDD cd01433  Ribosomal_L16_L10e  
Amino Acid Sequences QIRCRGDLAPRKFKYRKAFKGRLPIRTGGSTVATTLEHGDFGLRALEPCRLSAKTLQSCETAIKKAIKSAKGAKCYLRVFPDLPVCVKGNETRMGKGKGPFEFWACRVPVGRVLFEVGGGRIQKELAFAALQHAKPRLPIKTEFIDRDSKARLGNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.75
4 0.75
5 0.81
6 0.78
7 0.85
8 0.84
9 0.82
10 0.76
11 0.69
12 0.62
13 0.55
14 0.49
15 0.39
16 0.34
17 0.25
18 0.2
19 0.17
20 0.13
21 0.12
22 0.13
23 0.11
24 0.09
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.06
31 0.07
32 0.08
33 0.12
34 0.12
35 0.13
36 0.16
37 0.16
38 0.18
39 0.22
40 0.3
41 0.31
42 0.33
43 0.34
44 0.31
45 0.31
46 0.33
47 0.3
48 0.23
49 0.21
50 0.23
51 0.21
52 0.25
53 0.29
54 0.28
55 0.3
56 0.38
57 0.4
58 0.41
59 0.43
60 0.4
61 0.42
62 0.41
63 0.4
64 0.33
65 0.29
66 0.25
67 0.26
68 0.27
69 0.21
70 0.21
71 0.2
72 0.18
73 0.16
74 0.16
75 0.15
76 0.15
77 0.2
78 0.21
79 0.21
80 0.26
81 0.29
82 0.31
83 0.33
84 0.34
85 0.3
86 0.32
87 0.31
88 0.29
89 0.29
90 0.27
91 0.28
92 0.24
93 0.24
94 0.21
95 0.21
96 0.24
97 0.23
98 0.22
99 0.18
100 0.19
101 0.17
102 0.17
103 0.16
104 0.1
105 0.11
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.1
113 0.09
114 0.08
115 0.08
116 0.14
117 0.19
118 0.2
119 0.22
120 0.24
121 0.23
122 0.29
123 0.35
124 0.34
125 0.33
126 0.37
127 0.39
128 0.45
129 0.52
130 0.5
131 0.48
132 0.51
133 0.47
134 0.49
135 0.47
136 0.41