Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4RAK4

Protein Details
Accession F4RAK4    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
53-78IVKPHNKYRRTPPLKKRKETTRTPAAHydrophilic
NLS Segment(s)
PositionSequence
59-70KYRRTPPLKKRK
Subcellular Location(s) nucl 20, cyto_nucl 14, cyto 6
Family & Domain DBs
KEGG mlr:MELLADRAFT_103107  -  
Amino Acid Sequences MMRCRCSIAERGEGPRHHDTDQDLLHRVSQTRTARYYWLMRQIKISKRDMGYIVKPHNKYRRTPPLKKRKETTRTPAACAGITTGLYNVDRRGSQEDGPLMTSHQWNILNSQRYSRYCATEGSIHSPNESASYRRPSMPYSGNRGAVTGGSVCKRNKVPERRLVIGDKDIRGDLRSVGNEDWANSRQPSMTNERAATILRGGLERDADHSNYSFLSAPMILKELEGRRISSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.56
3 0.53
4 0.45
5 0.44
6 0.39
7 0.39
8 0.41
9 0.38
10 0.34
11 0.32
12 0.33
13 0.33
14 0.32
15 0.26
16 0.31
17 0.32
18 0.35
19 0.37
20 0.36
21 0.37
22 0.4
23 0.44
24 0.41
25 0.46
26 0.45
27 0.43
28 0.5
29 0.55
30 0.58
31 0.59
32 0.58
33 0.54
34 0.51
35 0.53
36 0.48
37 0.45
38 0.43
39 0.44
40 0.48
41 0.49
42 0.5
43 0.56
44 0.61
45 0.6
46 0.6
47 0.63
48 0.66
49 0.68
50 0.75
51 0.78
52 0.8
53 0.86
54 0.88
55 0.86
56 0.85
57 0.84
58 0.82
59 0.8
60 0.8
61 0.72
62 0.68
63 0.63
64 0.54
65 0.45
66 0.36
67 0.28
68 0.18
69 0.15
70 0.12
71 0.08
72 0.08
73 0.08
74 0.09
75 0.08
76 0.09
77 0.09
78 0.11
79 0.15
80 0.16
81 0.16
82 0.18
83 0.19
84 0.18
85 0.19
86 0.17
87 0.13
88 0.13
89 0.12
90 0.1
91 0.12
92 0.12
93 0.11
94 0.15
95 0.2
96 0.23
97 0.23
98 0.26
99 0.28
100 0.28
101 0.33
102 0.31
103 0.29
104 0.25
105 0.25
106 0.24
107 0.22
108 0.23
109 0.22
110 0.24
111 0.21
112 0.2
113 0.2
114 0.18
115 0.17
116 0.17
117 0.14
118 0.14
119 0.2
120 0.21
121 0.23
122 0.24
123 0.23
124 0.27
125 0.33
126 0.33
127 0.36
128 0.38
129 0.39
130 0.37
131 0.36
132 0.31
133 0.24
134 0.2
135 0.13
136 0.11
137 0.1
138 0.15
139 0.15
140 0.2
141 0.22
142 0.3
143 0.38
144 0.46
145 0.53
146 0.57
147 0.63
148 0.62
149 0.64
150 0.59
151 0.52
152 0.49
153 0.45
154 0.37
155 0.32
156 0.29
157 0.26
158 0.23
159 0.21
160 0.16
161 0.15
162 0.16
163 0.17
164 0.17
165 0.2
166 0.19
167 0.2
168 0.22
169 0.2
170 0.22
171 0.19
172 0.2
173 0.17
174 0.19
175 0.23
176 0.27
177 0.31
178 0.33
179 0.33
180 0.33
181 0.33
182 0.32
183 0.28
184 0.21
185 0.16
186 0.13
187 0.13
188 0.13
189 0.13
190 0.14
191 0.13
192 0.16
193 0.17
194 0.18
195 0.19
196 0.19
197 0.19
198 0.17
199 0.19
200 0.16
201 0.13
202 0.14
203 0.13
204 0.13
205 0.13
206 0.14
207 0.12
208 0.12
209 0.19
210 0.2
211 0.26
212 0.27