Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P5Y8

Protein Details
Accession R9P5Y8    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
91-113NTVSKFLERKKKKTLKNTDHEALHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016032  Sig_transdc_resp-reg_C-effctor  
IPR036388  WH-like_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MKLDDDLAAALGSLTSNASANDVKPAFYSVPKLADMPSPSTSSGRSATLTPSGTKVPIRRTTKAEQEIIMTMALSGKKPLQIAEALGLKANTVSKFLERKKKKTLKNTDHEALQLLMQSSPPRQRGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.06
5 0.09
6 0.1
7 0.1
8 0.17
9 0.17
10 0.17
11 0.17
12 0.2
13 0.18
14 0.19
15 0.23
16 0.18
17 0.2
18 0.21
19 0.21
20 0.19
21 0.21
22 0.22
23 0.22
24 0.22
25 0.21
26 0.21
27 0.22
28 0.21
29 0.2
30 0.19
31 0.16
32 0.15
33 0.14
34 0.15
35 0.17
36 0.18
37 0.15
38 0.16
39 0.15
40 0.16
41 0.18
42 0.19
43 0.23
44 0.31
45 0.36
46 0.37
47 0.42
48 0.45
49 0.5
50 0.51
51 0.45
52 0.37
53 0.33
54 0.3
55 0.25
56 0.2
57 0.12
58 0.07
59 0.08
60 0.08
61 0.06
62 0.07
63 0.07
64 0.09
65 0.09
66 0.1
67 0.1
68 0.1
69 0.11
70 0.13
71 0.15
72 0.13
73 0.14
74 0.13
75 0.11
76 0.11
77 0.13
78 0.1
79 0.1
80 0.11
81 0.15
82 0.23
83 0.31
84 0.41
85 0.47
86 0.54
87 0.63
88 0.71
89 0.76
90 0.79
91 0.83
92 0.83
93 0.84
94 0.86
95 0.79
96 0.71
97 0.63
98 0.54
99 0.43
100 0.33
101 0.26
102 0.18
103 0.14
104 0.14
105 0.15
106 0.19
107 0.27
108 0.3