Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9P0U9

Protein Details
Accession R9P0U9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
59-79EPIKVSQTKKQRIRTSPPETAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, extr 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MLLVPVYGRRCSLRAASCAGIMMPAISQTDLPPARRSELIVPCHRRDPTACRNKARDDEPIKVSQTKKQRIRTSPPETALSLPFARP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.34
3 0.33
4 0.31
5 0.3
6 0.26
7 0.19
8 0.13
9 0.1
10 0.06
11 0.05
12 0.05
13 0.05
14 0.06
15 0.06
16 0.13
17 0.14
18 0.16
19 0.19
20 0.2
21 0.22
22 0.22
23 0.23
24 0.24
25 0.28
26 0.33
27 0.38
28 0.42
29 0.41
30 0.45
31 0.44
32 0.38
33 0.34
34 0.36
35 0.38
36 0.44
37 0.48
38 0.5
39 0.54
40 0.58
41 0.6
42 0.55
43 0.54
44 0.48
45 0.48
46 0.46
47 0.46
48 0.43
49 0.44
50 0.43
51 0.4
52 0.45
53 0.5
54 0.55
55 0.61
56 0.67
57 0.7
58 0.78
59 0.82
60 0.81
61 0.78
62 0.74
63 0.67
64 0.6
65 0.54
66 0.46
67 0.4