Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P4W5

Protein Details
Accession R9P4W5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
60-83STEELQESSKRPKRQRRRPISDVTHydrophilic
NLS Segment(s)
PositionSequence
69-77KRPKRQRRR
Subcellular Location(s) mito 14, nucl 8, cyto_nucl 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MRLRPLQPTFSLKSRSSSASHRRSIVLEKVRPKTVLDLLTLLHFGLTFINSEMVELWTFSTEELQESSKRPKRQRRRPISDVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.41
3 0.38
4 0.42
5 0.46
6 0.48
7 0.51
8 0.48
9 0.47
10 0.46
11 0.47
12 0.47
13 0.45
14 0.43
15 0.46
16 0.49
17 0.5
18 0.48
19 0.44
20 0.38
21 0.34
22 0.3
23 0.23
24 0.19
25 0.17
26 0.16
27 0.16
28 0.12
29 0.07
30 0.05
31 0.05
32 0.04
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.08
48 0.07
49 0.08
50 0.09
51 0.11
52 0.13
53 0.17
54 0.28
55 0.34
56 0.43
57 0.52
58 0.62
59 0.71
60 0.8
61 0.88
62 0.89
63 0.91