Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R9L9

Protein Details
Accession F4R9L9    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-130RDRKGFHRIQVLSRKKKKMKBasic
NLS Segment(s)
PositionSequence
111-131RDRKGFHRIQVLSRKKKKMKI
Subcellular Location(s) nucl 20, mito 4, cyto 2
Family & Domain DBs
KEGG mlr:MELLADRAFT_60005  -  
Amino Acid Sequences MNFMITNYQQTTRYEELEAFKLQLALELLMGPAHVTPSLMGESQISPSTSCSSLPASLNPSPTVPFRQAASYPHRPPNPALERRRPMPLSFGNAPNEDRYGLQARGWLKQRDRKGFHRIQVLSRKKKKMKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.31
5 0.3
6 0.24
7 0.21
8 0.2
9 0.18
10 0.17
11 0.14
12 0.1
13 0.1
14 0.09
15 0.08
16 0.07
17 0.07
18 0.05
19 0.04
20 0.05
21 0.04
22 0.04
23 0.04
24 0.06
25 0.08
26 0.07
27 0.08
28 0.08
29 0.09
30 0.1
31 0.11
32 0.1
33 0.09
34 0.11
35 0.13
36 0.12
37 0.12
38 0.12
39 0.12
40 0.14
41 0.15
42 0.15
43 0.18
44 0.19
45 0.2
46 0.19
47 0.18
48 0.17
49 0.18
50 0.19
51 0.15
52 0.14
53 0.13
54 0.15
55 0.16
56 0.19
57 0.25
58 0.31
59 0.34
60 0.39
61 0.4
62 0.4
63 0.4
64 0.46
65 0.48
66 0.48
67 0.51
68 0.54
69 0.57
70 0.58
71 0.64
72 0.55
73 0.47
74 0.45
75 0.41
76 0.38
77 0.37
78 0.39
79 0.35
80 0.35
81 0.35
82 0.3
83 0.28
84 0.22
85 0.18
86 0.18
87 0.19
88 0.18
89 0.18
90 0.2
91 0.21
92 0.27
93 0.33
94 0.37
95 0.4
96 0.48
97 0.57
98 0.64
99 0.69
100 0.69
101 0.73
102 0.74
103 0.73
104 0.74
105 0.68
106 0.67
107 0.71
108 0.74
109 0.75
110 0.76
111 0.81