Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9P8Y7

Protein Details
Accession R9P8Y7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPSTPTSRPKQDKRRAANLLRDYYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10, mito 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014812  Vps51  
Gene Ontology GO:0005829  C:cytosol  
GO:0000938  C:GARP complex  
GO:0007030  P:Golgi organization  
GO:0006869  P:lipid transport  
GO:0015031  P:protein transport  
GO:0042147  P:retrograde transport, endosome to Golgi  
Pfam View protein in Pfam  
PF08700  Vps51  
Amino Acid Sequences MPSTPTSRPKQDKRRAANLLRDYYGLSSDATQTPESPAAPTEAKIDIQSLLRSSSLSVLLGKESELIVQIRELDGERQSLVYNHHHELVAASDTIRNMKVKSESLDPSLDSLKASFETMSTLASNLEVLRRPATEHSPAAELSKADSVDPLHDLEPIVTLPTTLSDLIECRHDAAEGAPRDEPEAKRAGLAQAEHLWGTMEPVLAAWTDAGVAGVREIAAECRTLLKDGRKAIGTPTAVRTT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.86
4 0.85
5 0.83
6 0.78
7 0.68
8 0.6
9 0.51
10 0.42
11 0.35
12 0.26
13 0.18
14 0.13
15 0.15
16 0.17
17 0.18
18 0.17
19 0.17
20 0.19
21 0.2
22 0.19
23 0.17
24 0.15
25 0.17
26 0.17
27 0.17
28 0.17
29 0.16
30 0.17
31 0.16
32 0.16
33 0.14
34 0.15
35 0.16
36 0.14
37 0.14
38 0.13
39 0.13
40 0.13
41 0.13
42 0.11
43 0.11
44 0.11
45 0.1
46 0.11
47 0.11
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.08
59 0.09
60 0.09
61 0.1
62 0.1
63 0.1
64 0.1
65 0.11
66 0.11
67 0.14
68 0.18
69 0.21
70 0.21
71 0.22
72 0.22
73 0.21
74 0.2
75 0.18
76 0.13
77 0.09
78 0.08
79 0.08
80 0.08
81 0.1
82 0.1
83 0.1
84 0.09
85 0.12
86 0.14
87 0.15
88 0.17
89 0.21
90 0.21
91 0.22
92 0.23
93 0.2
94 0.19
95 0.18
96 0.16
97 0.11
98 0.1
99 0.08
100 0.08
101 0.08
102 0.06
103 0.05
104 0.07
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.05
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.1
119 0.12
120 0.15
121 0.17
122 0.17
123 0.18
124 0.18
125 0.18
126 0.18
127 0.16
128 0.13
129 0.1
130 0.12
131 0.11
132 0.09
133 0.1
134 0.09
135 0.09
136 0.11
137 0.11
138 0.09
139 0.09
140 0.09
141 0.08
142 0.09
143 0.08
144 0.07
145 0.06
146 0.05
147 0.05
148 0.06
149 0.07
150 0.06
151 0.06
152 0.06
153 0.07
154 0.08
155 0.1
156 0.1
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.18
163 0.17
164 0.19
165 0.18
166 0.18
167 0.21
168 0.25
169 0.25
170 0.2
171 0.23
172 0.21
173 0.21
174 0.22
175 0.21
176 0.19
177 0.19
178 0.19
179 0.18
180 0.19
181 0.18
182 0.17
183 0.15
184 0.12
185 0.13
186 0.11
187 0.09
188 0.07
189 0.07
190 0.08
191 0.07
192 0.07
193 0.06
194 0.04
195 0.04
196 0.04
197 0.05
198 0.04
199 0.04
200 0.04
201 0.05
202 0.04
203 0.05
204 0.05
205 0.07
206 0.08
207 0.09
208 0.09
209 0.13
210 0.14
211 0.17
212 0.22
213 0.28
214 0.34
215 0.38
216 0.42
217 0.41
218 0.41
219 0.42
220 0.44
221 0.39
222 0.37