Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9NXB2

Protein Details
Accession R9NXB2   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
412-434EGKERKDMGTGKRHRRREEEGLFBasic
NLS Segment(s)
PositionSequence
422-428GKRHRRR
Subcellular Location(s) nucl 15, cyto 9, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001529  DNA-dir_RNA_pol_M/15kDasu  
IPR008551  TANGO2  
IPR001222  Znf_TFIIS  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF02150  RNA_POL_M_15KD  
PF05742  TANGO2  
PF01096  TFIIS_C  
PROSITE View protein in PROSITE  
PS51133  ZF_TFIIS_2  
Amino Acid Sequences MLFCPTCANCLIIQLDDQGNNKWSCHTCPYEFPIIRQMTTRQHLKRKEVDDVMGGEESWKNVDSIDGAYLLFCWRSILRDCTGSLIFDVWQCRSMVRYTVPCPKCENPKAFFMQLQIRSADEPMSVHTATTAMCVIFWTTKDPHYHLIIASNRDEYLSRPTLPASWHDFSSPTSSSTTTSSISPLVLSARDSTGGGTWLGVTRNGSWASLTNFTEQSAPLPAGLTAFESRGALVRDWLVSQTAFKGKARELDEVQREIEEYLSEVGSRADRYPGFNLLIAALSSSGVVVGYTTNRTTSGSVSLNTPPTIFSPTSNTPSPNGLSNSIITSPWSKINLGSHTFTSILSANSADLQEQLFDLLWTSSHPPPTQRSELRDSILISPLQLPGVQDAYATRTSTVILIGLYPSNFEGEGKERKDMGTGKRHRRREEEGLFGRLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.22
3 0.24
4 0.25
5 0.25
6 0.29
7 0.29
8 0.29
9 0.31
10 0.31
11 0.33
12 0.39
13 0.42
14 0.4
15 0.45
16 0.51
17 0.55
18 0.53
19 0.5
20 0.52
21 0.48
22 0.45
23 0.42
24 0.41
25 0.39
26 0.46
27 0.53
28 0.52
29 0.59
30 0.66
31 0.71
32 0.75
33 0.71
34 0.72
35 0.67
36 0.6
37 0.54
38 0.48
39 0.42
40 0.33
41 0.28
42 0.21
43 0.18
44 0.16
45 0.14
46 0.12
47 0.1
48 0.09
49 0.1
50 0.1
51 0.1
52 0.11
53 0.1
54 0.09
55 0.09
56 0.1
57 0.1
58 0.09
59 0.07
60 0.09
61 0.09
62 0.13
63 0.17
64 0.21
65 0.23
66 0.25
67 0.26
68 0.28
69 0.28
70 0.25
71 0.21
72 0.17
73 0.15
74 0.15
75 0.18
76 0.14
77 0.16
78 0.15
79 0.15
80 0.16
81 0.17
82 0.19
83 0.21
84 0.26
85 0.29
86 0.4
87 0.41
88 0.42
89 0.47
90 0.49
91 0.54
92 0.56
93 0.58
94 0.51
95 0.55
96 0.58
97 0.53
98 0.49
99 0.43
100 0.43
101 0.38
102 0.37
103 0.31
104 0.27
105 0.26
106 0.25
107 0.21
108 0.14
109 0.11
110 0.11
111 0.14
112 0.13
113 0.12
114 0.11
115 0.11
116 0.11
117 0.11
118 0.1
119 0.06
120 0.06
121 0.06
122 0.07
123 0.08
124 0.09
125 0.12
126 0.13
127 0.17
128 0.2
129 0.22
130 0.25
131 0.26
132 0.27
133 0.23
134 0.28
135 0.27
136 0.28
137 0.27
138 0.24
139 0.21
140 0.21
141 0.21
142 0.15
143 0.19
144 0.19
145 0.18
146 0.18
147 0.18
148 0.2
149 0.21
150 0.24
151 0.24
152 0.22
153 0.22
154 0.22
155 0.22
156 0.21
157 0.25
158 0.21
159 0.15
160 0.15
161 0.15
162 0.16
163 0.17
164 0.18
165 0.14
166 0.14
167 0.13
168 0.12
169 0.12
170 0.1
171 0.09
172 0.08
173 0.07
174 0.08
175 0.08
176 0.07
177 0.08
178 0.08
179 0.08
180 0.07
181 0.08
182 0.07
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.08
189 0.07
190 0.1
191 0.11
192 0.1
193 0.09
194 0.11
195 0.13
196 0.15
197 0.16
198 0.15
199 0.14
200 0.15
201 0.15
202 0.14
203 0.12
204 0.1
205 0.09
206 0.07
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.08
218 0.09
219 0.08
220 0.08
221 0.08
222 0.08
223 0.09
224 0.09
225 0.08
226 0.07
227 0.07
228 0.09
229 0.11
230 0.13
231 0.13
232 0.15
233 0.16
234 0.22
235 0.25
236 0.26
237 0.25
238 0.31
239 0.34
240 0.33
241 0.32
242 0.25
243 0.23
244 0.19
245 0.17
246 0.1
247 0.07
248 0.06
249 0.06
250 0.06
251 0.06
252 0.06
253 0.07
254 0.08
255 0.08
256 0.11
257 0.11
258 0.14
259 0.16
260 0.18
261 0.18
262 0.17
263 0.17
264 0.14
265 0.13
266 0.11
267 0.09
268 0.06
269 0.05
270 0.04
271 0.04
272 0.03
273 0.03
274 0.03
275 0.03
276 0.04
277 0.05
278 0.07
279 0.07
280 0.08
281 0.09
282 0.1
283 0.11
284 0.12
285 0.15
286 0.15
287 0.15
288 0.18
289 0.2
290 0.21
291 0.21
292 0.19
293 0.16
294 0.15
295 0.19
296 0.17
297 0.15
298 0.2
299 0.23
300 0.28
301 0.29
302 0.29
303 0.27
304 0.29
305 0.29
306 0.27
307 0.25
308 0.22
309 0.22
310 0.21
311 0.21
312 0.19
313 0.18
314 0.15
315 0.15
316 0.15
317 0.17
318 0.18
319 0.17
320 0.19
321 0.24
322 0.28
323 0.29
324 0.3
325 0.27
326 0.27
327 0.27
328 0.24
329 0.21
330 0.17
331 0.13
332 0.12
333 0.11
334 0.1
335 0.11
336 0.11
337 0.09
338 0.09
339 0.09
340 0.08
341 0.08
342 0.08
343 0.07
344 0.06
345 0.07
346 0.06
347 0.06
348 0.08
349 0.13
350 0.15
351 0.2
352 0.22
353 0.25
354 0.31
355 0.39
356 0.46
357 0.47
358 0.5
359 0.53
360 0.55
361 0.54
362 0.5
363 0.45
364 0.39
365 0.37
366 0.3
367 0.24
368 0.22
369 0.2
370 0.18
371 0.16
372 0.14
373 0.12
374 0.14
375 0.13
376 0.11
377 0.12
378 0.15
379 0.17
380 0.17
381 0.15
382 0.14
383 0.15
384 0.15
385 0.15
386 0.11
387 0.08
388 0.08
389 0.09
390 0.11
391 0.11
392 0.11
393 0.11
394 0.12
395 0.12
396 0.11
397 0.13
398 0.18
399 0.27
400 0.28
401 0.32
402 0.32
403 0.32
404 0.38
405 0.41
406 0.44
407 0.46
408 0.54
409 0.61
410 0.7
411 0.79
412 0.8
413 0.82
414 0.81
415 0.81
416 0.78
417 0.78
418 0.74