Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9NZ59

Protein Details
Accession R9NZ59    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
73-106LAEKTEKASRKLRKERKNRAKKVRGVKKTKAGEABasic
NLS Segment(s)
PositionSequence
74-110AEKTEKASRKLRKERKNRAKKVRGVKKTKAGEAAKKK
Subcellular Location(s) cyto 10cyto_nucl 10, mito 9, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MVLDVIHPARPNVSKAELSEKLSEMYKTPKEQCIVFGMRTAFGGGRSTGFALIYDSRDSMKFEPKHRLVRVGLAEKTEKASRKLRKERKNRAKKVRGVKKTKAGEAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.36
4 0.35
5 0.36
6 0.36
7 0.33
8 0.3
9 0.29
10 0.28
11 0.21
12 0.25
13 0.26
14 0.29
15 0.32
16 0.35
17 0.35
18 0.35
19 0.35
20 0.34
21 0.32
22 0.27
23 0.26
24 0.22
25 0.2
26 0.2
27 0.19
28 0.12
29 0.1
30 0.11
31 0.08
32 0.08
33 0.08
34 0.08
35 0.08
36 0.07
37 0.07
38 0.07
39 0.08
40 0.08
41 0.08
42 0.08
43 0.09
44 0.1
45 0.12
46 0.12
47 0.2
48 0.23
49 0.26
50 0.35
51 0.4
52 0.47
53 0.46
54 0.5
55 0.42
56 0.43
57 0.46
58 0.42
59 0.37
60 0.31
61 0.32
62 0.27
63 0.3
64 0.29
65 0.26
66 0.26
67 0.34
68 0.4
69 0.5
70 0.61
71 0.67
72 0.73
73 0.82
74 0.89
75 0.91
76 0.93
77 0.93
78 0.94
79 0.93
80 0.92
81 0.92
82 0.91
83 0.91
84 0.89
85 0.87
86 0.86
87 0.83
88 0.79
89 0.77
90 0.74