Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P3P1

Protein Details
Accession R9P3P1   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
84-114EKKVSVKKNKDLPTRMKKNHRPDQARKVLEAHydrophilic
NLS Segment(s)
PositionSequence
86-105KVSVKKNKDLPTRMKKNHRP
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MSTKPRSDSNTSTSSINNDPSSHITSSVFRSLPSYKSDQYDDLSHGSTSKARHWPGTKKNPGEGRSHFECRVTSADQVNASKEEKKVSVKKNKDLPTRMKKNHRPDQARKVLEAGERE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.32
4 0.28
5 0.24
6 0.25
7 0.28
8 0.31
9 0.27
10 0.25
11 0.22
12 0.22
13 0.25
14 0.27
15 0.23
16 0.19
17 0.22
18 0.24
19 0.24
20 0.26
21 0.27
22 0.25
23 0.28
24 0.3
25 0.28
26 0.28
27 0.27
28 0.25
29 0.22
30 0.2
31 0.17
32 0.15
33 0.14
34 0.14
35 0.14
36 0.17
37 0.22
38 0.22
39 0.28
40 0.33
41 0.41
42 0.48
43 0.58
44 0.6
45 0.56
46 0.6
47 0.61
48 0.59
49 0.56
50 0.48
51 0.45
52 0.42
53 0.44
54 0.39
55 0.34
56 0.31
57 0.28
58 0.29
59 0.24
60 0.21
61 0.18
62 0.2
63 0.21
64 0.22
65 0.21
66 0.19
67 0.19
68 0.2
69 0.19
70 0.2
71 0.21
72 0.28
73 0.35
74 0.43
75 0.52
76 0.57
77 0.64
78 0.71
79 0.77
80 0.78
81 0.77
82 0.78
83 0.79
84 0.82
85 0.83
86 0.85
87 0.85
88 0.87
89 0.89
90 0.89
91 0.88
92 0.87
93 0.89
94 0.88
95 0.82
96 0.72
97 0.65
98 0.59