Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9P526

Protein Details
Accession R9P526    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
63-84GPMCRARRVKFPRKGEPPFRTFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, mito_nucl 9, nucl 8.5, mito 8.5
Family & Domain DBs
Amino Acid Sequences MVADGRTEKERKREERVECGAKLRTACDVSRQSVHSKRRKTAFTHEQLLLKLDGQISCVGQQGPMCRARRVKFPRKGEPPFRTFAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.7
3 0.74
4 0.71
5 0.62
6 0.61
7 0.54
8 0.48
9 0.42
10 0.33
11 0.29
12 0.25
13 0.24
14 0.26
15 0.27
16 0.27
17 0.3
18 0.31
19 0.33
20 0.38
21 0.48
22 0.48
23 0.51
24 0.54
25 0.57
26 0.59
27 0.57
28 0.59
29 0.59
30 0.56
31 0.54
32 0.5
33 0.46
34 0.42
35 0.39
36 0.29
37 0.2
38 0.16
39 0.12
40 0.1
41 0.1
42 0.1
43 0.09
44 0.09
45 0.11
46 0.1
47 0.09
48 0.11
49 0.13
50 0.16
51 0.23
52 0.25
53 0.28
54 0.36
55 0.38
56 0.47
57 0.55
58 0.61
59 0.64
60 0.71
61 0.77
62 0.79
63 0.87
64 0.86
65 0.85
66 0.8
67 0.76