Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S9K5

Protein Details
Accession F4S9K5    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
77-100AGDNIPKSKHRTKRVWNPNVQKSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 12.833, nucl 10, cyto_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR034704  L28p-like  
IPR026569  Ribo_L28/L24  
IPR037147  Ribo_L28/L24_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
KEGG mlr:MELLADRAFT_50935  -  
Pfam View protein in Pfam  
PF00830  Ribosomal_L28  
Amino Acid Sequences MMKNLLRRFLSTNLKYSHSNQNFIKSNISTTSNQTQTQSQTQSPISYGVTYVPPLKITRQHTKRADYGLYDGLKVKAGDNIPKSKHRTKRVWNPNVQKSSLWSEVLNQSLQLKLTTAALKTIDKVGGLDRYVLQMSDQRLGGTGIRIRELVISAMKAKLKLSKGFTRPIPECEVWRIPQWQDSIERSDRLIIRKMVPSINVHQIKVFPRRLNVDGKLEKGSLNDLFQRGQKGSQTSRRSTHPRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.5
3 0.51
4 0.54
5 0.48
6 0.51
7 0.46
8 0.52
9 0.53
10 0.51
11 0.52
12 0.42
13 0.41
14 0.37
15 0.39
16 0.32
17 0.33
18 0.39
19 0.37
20 0.38
21 0.37
22 0.37
23 0.38
24 0.42
25 0.41
26 0.34
27 0.34
28 0.34
29 0.33
30 0.3
31 0.27
32 0.21
33 0.17
34 0.16
35 0.14
36 0.13
37 0.14
38 0.15
39 0.14
40 0.15
41 0.16
42 0.19
43 0.25
44 0.31
45 0.4
46 0.44
47 0.53
48 0.57
49 0.61
50 0.62
51 0.59
52 0.54
53 0.45
54 0.42
55 0.38
56 0.32
57 0.28
58 0.25
59 0.21
60 0.21
61 0.19
62 0.16
63 0.15
64 0.16
65 0.21
66 0.25
67 0.31
68 0.32
69 0.39
70 0.46
71 0.51
72 0.58
73 0.61
74 0.65
75 0.69
76 0.76
77 0.8
78 0.83
79 0.83
80 0.84
81 0.84
82 0.79
83 0.7
84 0.59
85 0.51
86 0.47
87 0.4
88 0.31
89 0.22
90 0.2
91 0.21
92 0.22
93 0.19
94 0.14
95 0.12
96 0.12
97 0.12
98 0.09
99 0.07
100 0.06
101 0.08
102 0.09
103 0.09
104 0.09
105 0.1
106 0.1
107 0.1
108 0.11
109 0.1
110 0.08
111 0.08
112 0.09
113 0.09
114 0.09
115 0.09
116 0.08
117 0.09
118 0.09
119 0.09
120 0.08
121 0.1
122 0.11
123 0.12
124 0.12
125 0.11
126 0.11
127 0.12
128 0.12
129 0.11
130 0.12
131 0.1
132 0.11
133 0.11
134 0.11
135 0.11
136 0.11
137 0.1
138 0.08
139 0.09
140 0.09
141 0.12
142 0.12
143 0.13
144 0.13
145 0.17
146 0.2
147 0.25
148 0.3
149 0.36
150 0.38
151 0.43
152 0.45
153 0.47
154 0.46
155 0.45
156 0.45
157 0.38
158 0.36
159 0.37
160 0.38
161 0.32
162 0.33
163 0.33
164 0.28
165 0.31
166 0.3
167 0.26
168 0.27
169 0.28
170 0.31
171 0.3
172 0.3
173 0.27
174 0.31
175 0.32
176 0.31
177 0.34
178 0.3
179 0.32
180 0.35
181 0.37
182 0.34
183 0.33
184 0.34
185 0.33
186 0.4
187 0.39
188 0.35
189 0.34
190 0.36
191 0.39
192 0.44
193 0.46
194 0.39
195 0.41
196 0.46
197 0.49
198 0.53
199 0.51
200 0.52
201 0.49
202 0.49
203 0.47
204 0.42
205 0.38
206 0.32
207 0.32
208 0.24
209 0.24
210 0.25
211 0.24
212 0.26
213 0.28
214 0.32
215 0.29
216 0.3
217 0.32
218 0.35
219 0.42
220 0.49
221 0.54
222 0.56
223 0.59
224 0.65