Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P1K0

Protein Details
Accession R9P1K0   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
176-197QESNPRVKKRGKASKKDGPDDDBasic
NLS Segment(s)
PositionSequence
181-191RVKKRGKASKK
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR027113  Transc_fact_NFYB/HAP3  
IPR003956  Transcrpt_fac_NFYB/HAP3_CS  
Gene Ontology GO:0016602  C:CCAAT-binding factor complex  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0046982  F:protein heterodimerization activity  
GO:0043565  F:sequence-specific DNA binding  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
PROSITE View protein in PROSITE  
PS00685  NFYB_HAP3  
Amino Acid Sequences MSTSTSTPIGAHTLLDASPSTHSTPASYASPSSHVNPSSHHSHPAAVHPPAHQQPHTGTSTPTSTSTTSIDPTNLSSHPTYAALFPDPDLPIANISRIMKRSLPENAKIAKDAKECVQDCVSELISFITSEASDKCSAEKRKTINGDDILYAMRVLGFDNYEEILRVYLSRYRMEQESNPRVKKRGKASKKDGPDDDDDEDDEDADEEGDDSRVASGFNSPMPGQASTLPTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.12
4 0.1
5 0.11
6 0.14
7 0.15
8 0.15
9 0.16
10 0.16
11 0.17
12 0.19
13 0.19
14 0.18
15 0.18
16 0.18
17 0.21
18 0.22
19 0.24
20 0.26
21 0.26
22 0.26
23 0.27
24 0.3
25 0.33
26 0.33
27 0.34
28 0.29
29 0.3
30 0.31
31 0.35
32 0.36
33 0.32
34 0.32
35 0.29
36 0.35
37 0.37
38 0.4
39 0.33
40 0.3
41 0.3
42 0.34
43 0.36
44 0.29
45 0.25
46 0.23
47 0.25
48 0.24
49 0.22
50 0.19
51 0.17
52 0.18
53 0.19
54 0.18
55 0.17
56 0.16
57 0.16
58 0.14
59 0.15
60 0.16
61 0.14
62 0.16
63 0.14
64 0.14
65 0.14
66 0.14
67 0.13
68 0.11
69 0.13
70 0.11
71 0.1
72 0.1
73 0.12
74 0.12
75 0.11
76 0.11
77 0.1
78 0.1
79 0.1
80 0.1
81 0.11
82 0.12
83 0.14
84 0.15
85 0.16
86 0.17
87 0.17
88 0.2
89 0.25
90 0.27
91 0.27
92 0.31
93 0.32
94 0.31
95 0.32
96 0.3
97 0.27
98 0.24
99 0.23
100 0.21
101 0.25
102 0.25
103 0.26
104 0.25
105 0.2
106 0.2
107 0.21
108 0.18
109 0.11
110 0.1
111 0.08
112 0.08
113 0.07
114 0.07
115 0.05
116 0.04
117 0.05
118 0.06
119 0.08
120 0.09
121 0.09
122 0.11
123 0.18
124 0.23
125 0.26
126 0.31
127 0.32
128 0.39
129 0.44
130 0.45
131 0.44
132 0.42
133 0.39
134 0.34
135 0.31
136 0.23
137 0.18
138 0.15
139 0.09
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.06
147 0.07
148 0.07
149 0.07
150 0.07
151 0.07
152 0.06
153 0.07
154 0.07
155 0.11
156 0.13
157 0.14
158 0.16
159 0.19
160 0.21
161 0.24
162 0.29
163 0.35
164 0.44
165 0.51
166 0.56
167 0.56
168 0.6
169 0.63
170 0.64
171 0.65
172 0.66
173 0.68
174 0.72
175 0.78
176 0.81
177 0.84
178 0.84
179 0.77
180 0.71
181 0.66
182 0.59
183 0.53
184 0.45
185 0.36
186 0.3
187 0.26
188 0.21
189 0.15
190 0.12
191 0.09
192 0.07
193 0.07
194 0.06
195 0.06
196 0.06
197 0.06
198 0.06
199 0.06
200 0.07
201 0.07
202 0.07
203 0.1
204 0.11
205 0.12
206 0.16
207 0.15
208 0.18
209 0.21
210 0.21
211 0.19
212 0.22