Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9PC08

Protein Details
Accession R9PC08    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
76-97SSELRRRSRKWLQELNRTKYSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022617  Rad60/SUMO-like_dom  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Pfam View protein in Pfam  
PF11976  Rad60-SLD  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
Amino Acid Sequences MSDAEAPQPKPEGGEQLNIKVKDADGNEVFFKVKRTTKLSKLKKAYAERMGKPENSVRFIFDGQRIGDNDTAETVSSELRRRSRKWLQELNRTKYSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.35
4 0.42
5 0.4
6 0.4
7 0.32
8 0.31
9 0.28
10 0.27
11 0.26
12 0.19
13 0.21
14 0.21
15 0.21
16 0.22
17 0.17
18 0.19
19 0.18
20 0.21
21 0.24
22 0.3
23 0.36
24 0.45
25 0.55
26 0.61
27 0.66
28 0.67
29 0.68
30 0.69
31 0.68
32 0.65
33 0.63
34 0.61
35 0.53
36 0.54
37 0.51
38 0.43
39 0.39
40 0.38
41 0.32
42 0.29
43 0.27
44 0.22
45 0.22
46 0.23
47 0.23
48 0.2
49 0.2
50 0.17
51 0.2
52 0.19
53 0.2
54 0.2
55 0.18
56 0.16
57 0.14
58 0.14
59 0.11
60 0.1
61 0.08
62 0.09
63 0.12
64 0.16
65 0.21
66 0.29
67 0.36
68 0.39
69 0.49
70 0.57
71 0.64
72 0.69
73 0.74
74 0.75
75 0.79
76 0.87
77 0.85