Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PA21

Protein Details
Accession R9PA21    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDRSRKQRKSTARQAAHHAYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, mito 5, E.R. 2, cyto 1, extr 1, pero 1, vacu 1, cyto_pero 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
GO:0004386  F:helicase activity  
Amino Acid Sequences MDRSRKQRKSTARQAAHHAYLAQAIADLARWGFSLAILRPRSPRISKVWLLSVLPVATALLLRAWICTFDSFDDLEALHLCHNLVQLCFRGAVALFGLLVLLLPRSHFAFERCHLSLKVLGLDVNLSQPMSRCA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.78
3 0.69
4 0.6
5 0.49
6 0.38
7 0.31
8 0.27
9 0.18
10 0.1
11 0.08
12 0.06
13 0.06
14 0.06
15 0.04
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.09
22 0.1
23 0.18
24 0.19
25 0.21
26 0.23
27 0.27
28 0.33
29 0.33
30 0.35
31 0.34
32 0.4
33 0.41
34 0.41
35 0.41
36 0.36
37 0.33
38 0.3
39 0.24
40 0.17
41 0.13
42 0.1
43 0.07
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.06
66 0.06
67 0.05
68 0.06
69 0.07
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.1
76 0.09
77 0.09
78 0.07
79 0.08
80 0.06
81 0.06
82 0.05
83 0.04
84 0.04
85 0.03
86 0.03
87 0.03
88 0.03
89 0.03
90 0.04
91 0.06
92 0.07
93 0.09
94 0.1
95 0.13
96 0.18
97 0.21
98 0.28
99 0.28
100 0.31
101 0.3
102 0.31
103 0.33
104 0.28
105 0.27
106 0.21
107 0.19
108 0.16
109 0.17
110 0.15
111 0.13
112 0.12
113 0.1
114 0.1