Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9NZJ1

Protein Details
Accession R9NZJ1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
42-67LKITTRRDPKRVRRRIMKFQRPARSHBasic
NLS Segment(s)
PositionSequence
47-76RRDPKRVRRRIMKFQRPARSHIRVRKASYR
Subcellular Location(s) nucl 11cysk 11, cyto_nucl 8, cyto 3
Family & Domain DBs
Gene Ontology GO:0005840  C:ribosome  
Amino Acid Sequences MIGSEEAETMMMVTLEMRILTQLQPERYCIGFQESHNSDCALKITTRRDPKRVRRRIMKFQRPARSHIRVRKASYRRLDNHSRLDAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.05
3 0.05
4 0.04
5 0.05
6 0.06
7 0.07
8 0.13
9 0.17
10 0.21
11 0.22
12 0.24
13 0.25
14 0.25
15 0.24
16 0.2
17 0.2
18 0.19
19 0.18
20 0.25
21 0.25
22 0.25
23 0.25
24 0.25
25 0.2
26 0.18
27 0.18
28 0.11
29 0.1
30 0.13
31 0.17
32 0.24
33 0.34
34 0.37
35 0.45
36 0.54
37 0.64
38 0.71
39 0.76
40 0.78
41 0.79
42 0.84
43 0.86
44 0.87
45 0.87
46 0.85
47 0.85
48 0.86
49 0.78
50 0.76
51 0.73
52 0.71
53 0.7
54 0.69
55 0.7
56 0.67
57 0.71
58 0.75
59 0.74
60 0.74
61 0.75
62 0.75
63 0.71
64 0.72
65 0.76
66 0.73
67 0.74