Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P8V3

Protein Details
Accession R9P8V3   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
39-65LISLRFCCCCKKRRRRFRQQTTLPVTDHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 14, mito 8, nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSSCNAYGYNYPCHLHLSSGARIGIGVGVAAGVLLIVLISLRFCCCCKKRRRRFRQQTTLPVTDQQNEMSNHQQGHGGGGYGQPYGQPCATHQKSYAYGEGQPYASPAGQPSTGADSSHYAPPPNPPPPAYKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.31
3 0.26
4 0.28
5 0.27
6 0.26
7 0.29
8 0.28
9 0.23
10 0.23
11 0.21
12 0.15
13 0.1
14 0.07
15 0.03
16 0.03
17 0.03
18 0.03
19 0.02
20 0.02
21 0.01
22 0.01
23 0.01
24 0.01
25 0.01
26 0.02
27 0.02
28 0.03
29 0.04
30 0.05
31 0.07
32 0.15
33 0.2
34 0.3
35 0.41
36 0.52
37 0.63
38 0.74
39 0.84
40 0.87
41 0.94
42 0.95
43 0.95
44 0.92
45 0.91
46 0.87
47 0.79
48 0.68
49 0.6
50 0.5
51 0.4
52 0.33
53 0.23
54 0.21
55 0.19
56 0.2
57 0.19
58 0.2
59 0.18
60 0.18
61 0.18
62 0.14
63 0.14
64 0.12
65 0.09
66 0.08
67 0.08
68 0.08
69 0.07
70 0.07
71 0.06
72 0.07
73 0.09
74 0.09
75 0.09
76 0.11
77 0.21
78 0.24
79 0.25
80 0.25
81 0.27
82 0.3
83 0.33
84 0.34
85 0.25
86 0.25
87 0.25
88 0.26
89 0.22
90 0.19
91 0.17
92 0.15
93 0.14
94 0.12
95 0.11
96 0.12
97 0.11
98 0.12
99 0.13
100 0.17
101 0.17
102 0.17
103 0.18
104 0.18
105 0.21
106 0.26
107 0.26
108 0.22
109 0.22
110 0.3
111 0.37
112 0.39
113 0.41
114 0.38