Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9PG13

Protein Details
Accession R9PG13    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-48VTLVQRRSHRKVAKNRSKRFRQLLSHydrophilic
NLS Segment(s)
PositionSequence
29-44RRSHRKVAKNRSKRFR
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 4, cyto 2
Family & Domain DBs
Amino Acid Sequences MGTETDGASARSLWVILSVLRRHVTLVQRRSHRKVAKNRSKRFRQLLSRHHRHPCITFQQHRRHLSEKQRIPFTVGSSAEQVRRDRPPPKASG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.15
5 0.16
6 0.19
7 0.2
8 0.2
9 0.21
10 0.26
11 0.32
12 0.35
13 0.41
14 0.45
15 0.53
16 0.6
17 0.65
18 0.68
19 0.68
20 0.68
21 0.71
22 0.75
23 0.78
24 0.81
25 0.85
26 0.85
27 0.86
28 0.85
29 0.81
30 0.78
31 0.77
32 0.75
33 0.76
34 0.77
35 0.75
36 0.74
37 0.73
38 0.67
39 0.6
40 0.54
41 0.5
42 0.49
43 0.51
44 0.53
45 0.55
46 0.62
47 0.69
48 0.7
49 0.68
50 0.63
51 0.63
52 0.65
53 0.67
54 0.65
55 0.63
56 0.64
57 0.59
58 0.59
59 0.53
60 0.46
61 0.42
62 0.35
63 0.3
64 0.29
65 0.31
66 0.3
67 0.32
68 0.32
69 0.3
70 0.36
71 0.41
72 0.45
73 0.51