Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PP44

Protein Details
Accession R9PP44    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-52TPSHARRQPRDRPQHRSPSQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, extr 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MATCVQKHLRNNLTRNFPVSPASTHPLILIVPTPSHARRQPRDRPQHRSPSQLRIASGIICELATRFTLHLEIRGPDAPSQWYSPPLSARLDVAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.63
3 0.55
4 0.47
5 0.42
6 0.37
7 0.32
8 0.27
9 0.29
10 0.25
11 0.23
12 0.22
13 0.19
14 0.17
15 0.15
16 0.11
17 0.08
18 0.08
19 0.09
20 0.13
21 0.13
22 0.18
23 0.23
24 0.3
25 0.37
26 0.46
27 0.55
28 0.62
29 0.72
30 0.75
31 0.79
32 0.78
33 0.81
34 0.75
35 0.74
36 0.67
37 0.63
38 0.62
39 0.55
40 0.47
41 0.38
42 0.36
43 0.27
44 0.23
45 0.16
46 0.09
47 0.07
48 0.07
49 0.05
50 0.05
51 0.06
52 0.06
53 0.06
54 0.07
55 0.1
56 0.1
57 0.13
58 0.14
59 0.14
60 0.17
61 0.19
62 0.2
63 0.18
64 0.2
65 0.2
66 0.21
67 0.23
68 0.21
69 0.23
70 0.23
71 0.26
72 0.27
73 0.27
74 0.28
75 0.26