Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R320

Protein Details
Accession F4R320   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
93-112EPLRAIRRELNRENRNKIRNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mlr:MELLADRAFT_86692  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTFIHQLKKPLSHSIPFAIRSISSSSSRHQKPIVSSSSAGQSTPISSVKAGTPLKGLGIIKGVGDPVAKPDEEYPSWLWSLIEPGMGAGKSDEPLRAIRRELNRENRNKIRNSNFLKGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.47
3 0.42
4 0.4
5 0.32
6 0.27
7 0.26
8 0.26
9 0.23
10 0.21
11 0.22
12 0.25
13 0.34
14 0.36
15 0.38
16 0.37
17 0.37
18 0.38
19 0.43
20 0.43
21 0.36
22 0.35
23 0.32
24 0.34
25 0.31
26 0.26
27 0.2
28 0.16
29 0.13
30 0.14
31 0.14
32 0.1
33 0.1
34 0.11
35 0.1
36 0.17
37 0.17
38 0.15
39 0.15
40 0.14
41 0.14
42 0.16
43 0.16
44 0.09
45 0.1
46 0.09
47 0.08
48 0.08
49 0.08
50 0.06
51 0.06
52 0.05
53 0.06
54 0.08
55 0.07
56 0.08
57 0.09
58 0.13
59 0.14
60 0.17
61 0.16
62 0.16
63 0.17
64 0.17
65 0.15
66 0.11
67 0.13
68 0.1
69 0.09
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.07
76 0.07
77 0.08
78 0.09
79 0.1
80 0.1
81 0.15
82 0.19
83 0.21
84 0.23
85 0.29
86 0.36
87 0.45
88 0.53
89 0.59
90 0.64
91 0.71
92 0.78
93 0.8
94 0.8
95 0.78
96 0.78
97 0.75
98 0.76
99 0.75
100 0.74