Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P0Q6

Protein Details
Accession R9P0Q6   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-53ACNCVSIRVWLKKRKRERKRYIYGIVQLHydrophilic
NLS Segment(s)
PositionSequence
37-45KKRKRERKR
Subcellular Location(s) nucl 16, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MWRGRDGERDRREGGSPQRDGGRIAACNCVSIRVWLKKRKRERKRYIYGIVQLDQQHRFYHQHYPVHLPHRQRTIYRLSGRHGSCSCSWRRIRCSGNCGIRSQRQSHCERCSDAGRTVCGCFGKHPGDGCWSLGFALSSDRCDAWLDVMGRLADC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.54
3 0.49
4 0.46
5 0.48
6 0.46
7 0.44
8 0.4
9 0.34
10 0.28
11 0.28
12 0.31
13 0.26
14 0.27
15 0.26
16 0.25
17 0.21
18 0.22
19 0.28
20 0.31
21 0.4
22 0.48
23 0.57
24 0.64
25 0.75
26 0.82
27 0.85
28 0.87
29 0.9
30 0.92
31 0.92
32 0.91
33 0.86
34 0.81
35 0.77
36 0.69
37 0.58
38 0.51
39 0.44
40 0.4
41 0.35
42 0.29
43 0.23
44 0.22
45 0.24
46 0.22
47 0.28
48 0.31
49 0.32
50 0.33
51 0.39
52 0.41
53 0.44
54 0.45
55 0.41
56 0.39
57 0.42
58 0.43
59 0.37
60 0.36
61 0.37
62 0.41
63 0.41
64 0.39
65 0.34
66 0.4
67 0.39
68 0.41
69 0.35
70 0.31
71 0.28
72 0.31
73 0.31
74 0.32
75 0.36
76 0.36
77 0.41
78 0.45
79 0.5
80 0.49
81 0.54
82 0.53
83 0.58
84 0.54
85 0.52
86 0.5
87 0.49
88 0.49
89 0.48
90 0.46
91 0.44
92 0.49
93 0.54
94 0.53
95 0.5
96 0.49
97 0.47
98 0.46
99 0.43
100 0.41
101 0.36
102 0.33
103 0.32
104 0.3
105 0.28
106 0.25
107 0.22
108 0.19
109 0.22
110 0.23
111 0.24
112 0.25
113 0.24
114 0.28
115 0.29
116 0.28
117 0.23
118 0.2
119 0.17
120 0.16
121 0.15
122 0.1
123 0.15
124 0.14
125 0.15
126 0.17
127 0.17
128 0.17
129 0.19
130 0.19
131 0.15
132 0.2
133 0.2
134 0.18
135 0.21