Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PCD5

Protein Details
Accession R9PCD5   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
141-165VKQKLEERRLRREEKLRKLQQDEAEBasic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11, cyto 4.5, mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDQASTSADAPLSALSSSTLGSAPKRIRHRETQIGTAYELQRNAAMKGALLYTALGASSCFMAHHLFPGFRRQTLALKGFITSGFTIFGFVVGADTVLLSHESQQRSEENMVRSRARAELGKKGIVASEKEIEKWKDEYVKQKLEERRLRREEKLRKLQQDEAESGSSST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.08
6 0.08
7 0.09
8 0.1
9 0.11
10 0.19
11 0.23
12 0.3
13 0.39
14 0.46
15 0.52
16 0.59
17 0.66
18 0.69
19 0.68
20 0.67
21 0.63
22 0.57
23 0.52
24 0.48
25 0.42
26 0.34
27 0.3
28 0.24
29 0.21
30 0.21
31 0.2
32 0.16
33 0.14
34 0.11
35 0.12
36 0.11
37 0.09
38 0.08
39 0.07
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.05
50 0.06
51 0.06
52 0.09
53 0.1
54 0.11
55 0.11
56 0.2
57 0.21
58 0.2
59 0.21
60 0.21
61 0.23
62 0.27
63 0.29
64 0.22
65 0.21
66 0.21
67 0.2
68 0.18
69 0.16
70 0.11
71 0.08
72 0.07
73 0.07
74 0.07
75 0.06
76 0.06
77 0.05
78 0.04
79 0.04
80 0.04
81 0.04
82 0.03
83 0.03
84 0.03
85 0.03
86 0.04
87 0.04
88 0.07
89 0.12
90 0.13
91 0.14
92 0.16
93 0.17
94 0.19
95 0.23
96 0.24
97 0.23
98 0.27
99 0.31
100 0.3
101 0.29
102 0.28
103 0.26
104 0.23
105 0.24
106 0.23
107 0.28
108 0.31
109 0.31
110 0.3
111 0.29
112 0.29
113 0.26
114 0.25
115 0.19
116 0.21
117 0.21
118 0.22
119 0.29
120 0.28
121 0.29
122 0.29
123 0.29
124 0.32
125 0.35
126 0.43
127 0.46
128 0.52
129 0.52
130 0.58
131 0.62
132 0.65
133 0.7
134 0.68
135 0.7
136 0.72
137 0.75
138 0.76
139 0.79
140 0.79
141 0.8
142 0.84
143 0.82
144 0.82
145 0.82
146 0.81
147 0.78
148 0.73
149 0.65
150 0.58
151 0.5