Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P172

Protein Details
Accession R9P172    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
188-209REWNNKMVKKKEKELNMPPAPRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, nucl 9, cyto_nucl 8.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MAAADAKPTNVYIHRQAGTPKSCFVCYKSSPHVLVSQSIPTLDFLYVCHAHLADRHFATKLSDPASSPSAATSGERLPDKVSQDEIAKIKAEYEAKQKAKEAAKDSDKDKQASKPFTAMGVAGSVFSTVTSTVSGLASSAISSIPGEAPASTAAATTPSPAAAETLAKQHPLHAKYALHREFYAARVREWNNKMVKKKEKELNMPPAPRNALS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.4
4 0.45
5 0.47
6 0.44
7 0.43
8 0.39
9 0.41
10 0.41
11 0.39
12 0.39
13 0.37
14 0.42
15 0.44
16 0.47
17 0.45
18 0.45
19 0.46
20 0.39
21 0.38
22 0.33
23 0.28
24 0.22
25 0.21
26 0.2
27 0.16
28 0.15
29 0.13
30 0.1
31 0.08
32 0.14
33 0.14
34 0.14
35 0.14
36 0.13
37 0.13
38 0.16
39 0.19
40 0.18
41 0.18
42 0.19
43 0.19
44 0.2
45 0.22
46 0.23
47 0.23
48 0.21
49 0.2
50 0.2
51 0.22
52 0.24
53 0.21
54 0.17
55 0.13
56 0.12
57 0.11
58 0.11
59 0.1
60 0.09
61 0.12
62 0.13
63 0.13
64 0.15
65 0.18
66 0.2
67 0.19
68 0.19
69 0.17
70 0.18
71 0.22
72 0.21
73 0.18
74 0.17
75 0.15
76 0.14
77 0.16
78 0.16
79 0.15
80 0.21
81 0.28
82 0.29
83 0.31
84 0.31
85 0.34
86 0.36
87 0.39
88 0.36
89 0.34
90 0.37
91 0.38
92 0.39
93 0.4
94 0.39
95 0.36
96 0.34
97 0.33
98 0.35
99 0.36
100 0.35
101 0.3
102 0.27
103 0.26
104 0.24
105 0.18
106 0.11
107 0.08
108 0.07
109 0.06
110 0.05
111 0.05
112 0.04
113 0.04
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.05
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.04
126 0.05
127 0.04
128 0.04
129 0.04
130 0.05
131 0.05
132 0.05
133 0.06
134 0.05
135 0.06
136 0.06
137 0.07
138 0.06
139 0.06
140 0.05
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.07
150 0.09
151 0.09
152 0.14
153 0.15
154 0.17
155 0.17
156 0.21
157 0.28
158 0.28
159 0.3
160 0.3
161 0.32
162 0.36
163 0.47
164 0.45
165 0.4
166 0.38
167 0.39
168 0.36
169 0.36
170 0.39
171 0.3
172 0.29
173 0.34
174 0.37
175 0.44
176 0.45
177 0.5
178 0.5
179 0.57
180 0.64
181 0.66
182 0.73
183 0.71
184 0.77
185 0.78
186 0.78
187 0.8
188 0.81
189 0.81
190 0.8
191 0.79
192 0.73
193 0.71