Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PM37

Protein Details
Accession R9PM37   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
123-151YKKFESKDDKDEKKRRSPRRGRPDIAARTBasic
NLS Segment(s)
PositionSequence
132-145KDEKKRRSPRRGRP
Subcellular Location(s) nucl 9.5, mito_nucl 9.333, mito 8, cyto_mito 7.833, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRIVPTSCILLILAYTARSAIASSKPACPRSKYPPSRYALSTDTVCLRLLPISAATTAATLECRVQGDESPEAALRQVDEHAIRSMYCALGCDSVVNNRTRSALAPYVKPNCWVEKEENRVEYKKFESKDDKDEKKRRSPRRGRPDIAARTETRDIDAYTIGSATFRFCCTDTNREVYSEAAAKRIGLELSICDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.07
5 0.07
6 0.08
7 0.09
8 0.12
9 0.18
10 0.2
11 0.28
12 0.34
13 0.4
14 0.44
15 0.47
16 0.51
17 0.55
18 0.65
19 0.67
20 0.68
21 0.71
22 0.72
23 0.7
24 0.65
25 0.6
26 0.51
27 0.44
28 0.37
29 0.3
30 0.27
31 0.23
32 0.22
33 0.17
34 0.15
35 0.12
36 0.11
37 0.1
38 0.09
39 0.08
40 0.08
41 0.09
42 0.08
43 0.08
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.07
50 0.08
51 0.08
52 0.09
53 0.1
54 0.13
55 0.14
56 0.14
57 0.14
58 0.13
59 0.13
60 0.12
61 0.11
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.09
68 0.1
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.1
82 0.13
83 0.14
84 0.14
85 0.14
86 0.15
87 0.15
88 0.15
89 0.16
90 0.18
91 0.18
92 0.21
93 0.26
94 0.29
95 0.29
96 0.31
97 0.29
98 0.26
99 0.27
100 0.27
101 0.28
102 0.31
103 0.38
104 0.39
105 0.4
106 0.41
107 0.41
108 0.39
109 0.36
110 0.33
111 0.33
112 0.31
113 0.34
114 0.39
115 0.4
116 0.49
117 0.56
118 0.6
119 0.65
120 0.72
121 0.73
122 0.76
123 0.82
124 0.82
125 0.84
126 0.86
127 0.86
128 0.89
129 0.91
130 0.84
131 0.82
132 0.82
133 0.78
134 0.73
135 0.67
136 0.56
137 0.52
138 0.52
139 0.43
140 0.35
141 0.29
142 0.24
143 0.2
144 0.2
145 0.14
146 0.12
147 0.11
148 0.09
149 0.08
150 0.08
151 0.09
152 0.09
153 0.1
154 0.12
155 0.12
156 0.18
157 0.23
158 0.31
159 0.33
160 0.38
161 0.38
162 0.37
163 0.38
164 0.33
165 0.31
166 0.3
167 0.25
168 0.22
169 0.21
170 0.19
171 0.19
172 0.21
173 0.17
174 0.12
175 0.12
176 0.14