Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P812

Protein Details
Accession R9P812    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPSSKGKPTDPKKREEAKKEBasic
96-127AKDESAKEEKPKKPRTKKEPKPAAKGTREQPKBasic
NLS Segment(s)
PositionSequence
9-19TDPKKREEAKK
67-132PSPKKKAIESGERKDPSEAVGTPKKRKTEAKDESAKEEKPKKPRTKKEPKPAAKGTREQPKRGVKK
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPSSKGKPTDPKKREEAKKEVLNMEKGGGKGQWSAWKAAEMSKKYEAKGGKYEDTGDNPNQAKTGAPSPKKKAIESGERKDPSEAVGTPKKRKTEAKDESAKEEKPKKPRTKKEPKPAAKGTREQPKRGVKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.76
5 0.77
6 0.76
7 0.72
8 0.67
9 0.6
10 0.52
11 0.45
12 0.38
13 0.31
14 0.27
15 0.21
16 0.17
17 0.15
18 0.17
19 0.22
20 0.21
21 0.23
22 0.22
23 0.23
24 0.22
25 0.26
26 0.31
27 0.26
28 0.29
29 0.34
30 0.36
31 0.35
32 0.39
33 0.36
34 0.32
35 0.36
36 0.36
37 0.31
38 0.29
39 0.32
40 0.28
41 0.29
42 0.29
43 0.23
44 0.24
45 0.23
46 0.22
47 0.19
48 0.18
49 0.15
50 0.13
51 0.19
52 0.21
53 0.26
54 0.31
55 0.36
56 0.44
57 0.45
58 0.44
59 0.44
60 0.42
61 0.47
62 0.5
63 0.51
64 0.53
65 0.52
66 0.53
67 0.47
68 0.41
69 0.32
70 0.27
71 0.22
72 0.19
73 0.26
74 0.31
75 0.37
76 0.42
77 0.44
78 0.46
79 0.53
80 0.54
81 0.57
82 0.6
83 0.62
84 0.67
85 0.65
86 0.68
87 0.65
88 0.6
89 0.57
90 0.59
91 0.56
92 0.57
93 0.66
94 0.7
95 0.76
96 0.84
97 0.87
98 0.89
99 0.93
100 0.94
101 0.94
102 0.93
103 0.91
104 0.91
105 0.89
106 0.86
107 0.83
108 0.8
109 0.8
110 0.78
111 0.72
112 0.72