Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9P2I0

Protein Details
Accession R9P2I0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
9-28LDTNKKREKVWEKRKDRIDVBasic
NLS Segment(s)
Subcellular Location(s) cyto 15.5, cyto_nucl 12, nucl 7.5, mito 3
Family & Domain DBs
Amino Acid Sequences MFAIIDLTLDTNKKREKVWEKRKDRIDVATAPKSDGSIDRVFQRKRLAVTALVKNAEKAGSRFTLSSILIRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.36
3 0.44
4 0.54
5 0.64
6 0.68
7 0.71
8 0.78
9 0.84
10 0.8
11 0.72
12 0.64
13 0.58
14 0.54
15 0.52
16 0.49
17 0.41
18 0.36
19 0.33
20 0.29
21 0.24
22 0.18
23 0.16
24 0.12
25 0.13
26 0.17
27 0.24
28 0.25
29 0.27
30 0.31
31 0.29
32 0.3
33 0.32
34 0.29
35 0.28
36 0.34
37 0.37
38 0.35
39 0.35
40 0.33
41 0.31
42 0.3
43 0.26
44 0.21
45 0.17
46 0.18
47 0.18
48 0.2
49 0.2
50 0.2
51 0.23
52 0.22