Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9NWJ9

Protein Details
Accession R9NWJ9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
63-87QSKVARSSGRGKRRRTYRRSDAGGGHydrophilic
NLS Segment(s)
PositionSequence
68-81RSSGRGKRRRTYRR
Subcellular Location(s) cyto 10.5cyto_nucl 10.5, nucl 9.5, mito 4
Family & Domain DBs
Amino Acid Sequences MDDSERGQEAVRRFRASHGCEARARDTGMEKLLPNVATEIGDAPQITGGWLYVVRQVLDRKCQSKVARSSGRGKRRRTYRRSDAGGGTNGGEKKGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.5
4 0.54
5 0.51
6 0.51
7 0.51
8 0.54
9 0.5
10 0.44
11 0.39
12 0.31
13 0.27
14 0.25
15 0.23
16 0.21
17 0.18
18 0.17
19 0.19
20 0.17
21 0.15
22 0.13
23 0.11
24 0.09
25 0.09
26 0.09
27 0.06
28 0.07
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.04
35 0.04
36 0.03
37 0.04
38 0.04
39 0.06
40 0.07
41 0.07
42 0.1
43 0.14
44 0.16
45 0.24
46 0.28
47 0.28
48 0.3
49 0.37
50 0.37
51 0.42
52 0.47
53 0.49
54 0.52
55 0.54
56 0.63
57 0.65
58 0.72
59 0.72
60 0.71
61 0.71
62 0.75
63 0.81
64 0.79
65 0.8
66 0.81
67 0.83
68 0.82
69 0.78
70 0.72
71 0.67
72 0.61
73 0.52
74 0.42
75 0.38
76 0.32