Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PB86

Protein Details
Accession R9PB86    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-79MAVSRRRWWWWRRRRVWPIVAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, pero 2
Family & Domain DBs
Amino Acid Sequences MSTLYQTKCPQVSLGANAPGKSSGDNGRVEPTMKATAEREGFRFLRSEHDFWLCLSFMAVSRRRWWWWRRRRVWPIVAVARFGFGKRCAAAERRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.33
5 0.32
6 0.28
7 0.25
8 0.21
9 0.19
10 0.17
11 0.2
12 0.21
13 0.21
14 0.23
15 0.24
16 0.24
17 0.22
18 0.2
19 0.19
20 0.17
21 0.18
22 0.16
23 0.2
24 0.22
25 0.22
26 0.2
27 0.22
28 0.22
29 0.21
30 0.21
31 0.17
32 0.22
33 0.24
34 0.24
35 0.21
36 0.23
37 0.22
38 0.21
39 0.23
40 0.15
41 0.11
42 0.1
43 0.08
44 0.09
45 0.15
46 0.19
47 0.19
48 0.22
49 0.26
50 0.29
51 0.37
52 0.44
53 0.49
54 0.56
55 0.65
56 0.71
57 0.79
58 0.85
59 0.86
60 0.84
61 0.79
62 0.77
63 0.74
64 0.66
65 0.57
66 0.47
67 0.4
68 0.34
69 0.28
70 0.24
71 0.17
72 0.2
73 0.19
74 0.21
75 0.25