Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9PHE2

Protein Details
Accession R9PHE2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
78-99AAKLRLQRRRAWHRRAAPPFGIHydrophilic
NLS Segment(s)
PositionSequence
86-87RR
Subcellular Location(s) mito 15, nucl 8, cyto 2
Family & Domain DBs
Amino Acid Sequences MHSLGSLRSVRHESHIAVMHVECKQRRWKDSNAALRRCVALSSQTLVAGEMSRSWYCMILICILRHLQADVERPMEAAAKLRLQRRRAWHRRAAPPFGITF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.3
4 0.28
5 0.27
6 0.26
7 0.26
8 0.3
9 0.26
10 0.26
11 0.35
12 0.4
13 0.47
14 0.49
15 0.53
16 0.58
17 0.66
18 0.71
19 0.71
20 0.68
21 0.62
22 0.58
23 0.52
24 0.42
25 0.32
26 0.22
27 0.16
28 0.13
29 0.13
30 0.13
31 0.12
32 0.11
33 0.11
34 0.1
35 0.08
36 0.06
37 0.05
38 0.07
39 0.07
40 0.08
41 0.08
42 0.08
43 0.08
44 0.09
45 0.1
46 0.1
47 0.12
48 0.12
49 0.13
50 0.13
51 0.14
52 0.13
53 0.12
54 0.1
55 0.11
56 0.15
57 0.16
58 0.17
59 0.16
60 0.16
61 0.16
62 0.16
63 0.14
64 0.13
65 0.13
66 0.18
67 0.22
68 0.3
69 0.36
70 0.38
71 0.45
72 0.53
73 0.62
74 0.67
75 0.71
76 0.75
77 0.77
78 0.85
79 0.86
80 0.83
81 0.76