Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4R7X3

Protein Details
Accession F4R7X3    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
43-69SSIPSNWKSSKPKNKPNRYKLKTHQGAHydrophilic
NLS Segment(s)
PositionSequence
53-62KPKNKPNRYK
99-103KKRKL
Subcellular Location(s) mito 15, nucl 9, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021137  Ribosomal_L35  
IPR018265  Ribosomal_L35_CS  
IPR001706  Ribosomal_L35_non-mt  
IPR037229  Ribosomal_L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG mlr:MELLADRAFT_74050  -  
Pfam View protein in Pfam  
PF01632  Ribosomal_L35p  
PROSITE View protein in PROSITE  
PS00936  RIBOSOMAL_L35  
Amino Acid Sequences MSISMLTSLTHRSTQSRLSSRLYHQFSLPRLNITITPLRLFSSSIPSNWKSSKPKNKPNRYKLKTHQGASKRFFVTGHGQFKRSQAGKQHLMTGTSHSKKRKLKPMIIVNKTHTTKLRKLLPYVGKRAGFRKVNEVDSVWWSTGRLQKSGSALRLAILRAKGFEKLKISGSTQSDSISNSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.43
4 0.44
5 0.47
6 0.51
7 0.54
8 0.6
9 0.58
10 0.5
11 0.47
12 0.49
13 0.47
14 0.5
15 0.44
16 0.37
17 0.33
18 0.33
19 0.3
20 0.29
21 0.32
22 0.24
23 0.24
24 0.23
25 0.23
26 0.22
27 0.22
28 0.18
29 0.2
30 0.2
31 0.21
32 0.26
33 0.27
34 0.31
35 0.32
36 0.38
37 0.39
38 0.48
39 0.58
40 0.62
41 0.71
42 0.77
43 0.86
44 0.9
45 0.91
46 0.92
47 0.86
48 0.85
49 0.83
50 0.83
51 0.8
52 0.72
53 0.69
54 0.66
55 0.7
56 0.63
57 0.62
58 0.51
59 0.44
60 0.41
61 0.36
62 0.35
63 0.34
64 0.4
65 0.35
66 0.35
67 0.36
68 0.38
69 0.41
70 0.35
71 0.3
72 0.27
73 0.33
74 0.37
75 0.36
76 0.39
77 0.32
78 0.32
79 0.3
80 0.27
81 0.28
82 0.27
83 0.31
84 0.3
85 0.37
86 0.44
87 0.52
88 0.58
89 0.58
90 0.61
91 0.65
92 0.73
93 0.75
94 0.72
95 0.68
96 0.62
97 0.62
98 0.57
99 0.5
100 0.45
101 0.41
102 0.41
103 0.45
104 0.49
105 0.44
106 0.45
107 0.52
108 0.55
109 0.55
110 0.56
111 0.55
112 0.5
113 0.49
114 0.5
115 0.5
116 0.46
117 0.41
118 0.43
119 0.41
120 0.41
121 0.4
122 0.38
123 0.32
124 0.3
125 0.31
126 0.22
127 0.18
128 0.16
129 0.19
130 0.23
131 0.23
132 0.22
133 0.21
134 0.24
135 0.3
136 0.34
137 0.32
138 0.29
139 0.26
140 0.26
141 0.27
142 0.25
143 0.23
144 0.2
145 0.19
146 0.19
147 0.2
148 0.25
149 0.25
150 0.3
151 0.29
152 0.3
153 0.34
154 0.35
155 0.36
156 0.37
157 0.39
158 0.36
159 0.33
160 0.32
161 0.28