Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4SD62

Protein Details
Accession F4SD62    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
78-102KEPVETRKAKPKGQKNPPKKLLDPIBasic
NLS Segment(s)
PositionSequence
84-97RKAKPKGQKNPPKK
Subcellular Location(s) nucl 14, mito_nucl 11.499, cyto_nucl 10.833, mito 7.5, cyto 4.5
Family & Domain DBs
KEGG mlr:MELLADRAFT_114359  -  
Amino Acid Sequences MGSQSSQLSTSSNPKIKIKVSLVPDFDSVTSEDNYDLCDGPLEDLDVLDTEVLKDISIAMVTQMAFISFYCKVEPEDKEPVETRKAKPKGQKNPPKKLLDPIEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.45
4 0.5
5 0.46
6 0.44
7 0.45
8 0.47
9 0.46
10 0.43
11 0.42
12 0.35
13 0.3
14 0.25
15 0.2
16 0.15
17 0.13
18 0.11
19 0.11
20 0.1
21 0.1
22 0.1
23 0.1
24 0.07
25 0.07
26 0.07
27 0.07
28 0.07
29 0.07
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.03
42 0.03
43 0.03
44 0.04
45 0.03
46 0.03
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.05
54 0.08
55 0.08
56 0.09
57 0.09
58 0.1
59 0.12
60 0.17
61 0.2
62 0.23
63 0.3
64 0.3
65 0.34
66 0.36
67 0.37
68 0.4
69 0.43
70 0.42
71 0.44
72 0.5
73 0.53
74 0.6
75 0.67
76 0.7
77 0.76
78 0.83
79 0.82
80 0.88
81 0.9
82 0.88
83 0.81
84 0.8