Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4S946

Protein Details
Accession F4S946    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
2-24APTNFNKPLKKIRTNPKPVTDRQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 4
Family & Domain DBs
KEGG mlr:MELLADRAFT_69022  -  
Amino Acid Sequences MAPTNFNKPLKKIRTNPKPVTDRQLAFLAQKKRDQHQTIKSQSHFIRRKNGVKTGEGSNDAPSQDATWPDDGMTNPGFDDLEDQYRQGYDPAQATNLDDYTDEDGWEDVDEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.85
4 0.85
5 0.82
6 0.77
7 0.76
8 0.72
9 0.62
10 0.55
11 0.5
12 0.41
13 0.38
14 0.4
15 0.39
16 0.35
17 0.39
18 0.4
19 0.42
20 0.51
21 0.53
22 0.54
23 0.56
24 0.62
25 0.64
26 0.67
27 0.63
28 0.6
29 0.58
30 0.59
31 0.57
32 0.51
33 0.52
34 0.52
35 0.58
36 0.56
37 0.6
38 0.52
39 0.48
40 0.47
41 0.4
42 0.35
43 0.31
44 0.27
45 0.22
46 0.2
47 0.18
48 0.15
49 0.12
50 0.11
51 0.1
52 0.1
53 0.1
54 0.1
55 0.1
56 0.1
57 0.11
58 0.1
59 0.12
60 0.12
61 0.1
62 0.09
63 0.1
64 0.09
65 0.08
66 0.1
67 0.09
68 0.13
69 0.13
70 0.14
71 0.14
72 0.14
73 0.15
74 0.13
75 0.12
76 0.11
77 0.13
78 0.14
79 0.15
80 0.16
81 0.17
82 0.18
83 0.17
84 0.15
85 0.13
86 0.14
87 0.17
88 0.17
89 0.15
90 0.13
91 0.13
92 0.13