Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P8U0

Protein Details
Accession R9P8U0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40ALPCSFGLRNHRKLRRRIAKFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9, extr 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MHTGMMPATASSLRLYISWALPCSFGLRNHRKLRRRIAKFVFCNFAAAPRNFDHLLSSPRRVIGDGASEAQLRLHSLSPLGSAAGNTLRLCVCVPFGCTFGSSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.12
3 0.12
4 0.15
5 0.16
6 0.17
7 0.17
8 0.17
9 0.18
10 0.19
11 0.2
12 0.22
13 0.3
14 0.37
15 0.46
16 0.55
17 0.64
18 0.69
19 0.74
20 0.8
21 0.81
22 0.79
23 0.8
24 0.79
25 0.79
26 0.77
27 0.72
28 0.65
29 0.54
30 0.49
31 0.39
32 0.34
33 0.3
34 0.24
35 0.24
36 0.21
37 0.24
38 0.22
39 0.22
40 0.19
41 0.16
42 0.21
43 0.21
44 0.22
45 0.19
46 0.2
47 0.2
48 0.19
49 0.17
50 0.13
51 0.13
52 0.12
53 0.13
54 0.13
55 0.13
56 0.12
57 0.12
58 0.11
59 0.08
60 0.09
61 0.09
62 0.08
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.08
69 0.07
70 0.08
71 0.09
72 0.11
73 0.11
74 0.12
75 0.12
76 0.12
77 0.13
78 0.12
79 0.14
80 0.13
81 0.16
82 0.16
83 0.17
84 0.17
85 0.17