Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9P1Z6

Protein Details
Accession R9P1Z6    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
129-148TAPRRKPTSVRPFPPMRRHPBasic
NLS Segment(s)
Subcellular Location(s) nucl 11mito 11mito_nucl 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR003657  WRKY_dom  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
PROSITE View protein in PROSITE  
PS50811  WRKY  
Amino Acid Sequences MDAALGGGAGRSKLRSKPQSELGSRAGANWRGRGTDERKWPIEVGAYPLIFCSVTSQFLARSNRAYEDRWLWRQTKCKPVRFSRLQRLFSHCEYLALALQRCAARCPSEEVRHVQYSRFTSMANLANCTAPRRKPTSVRPFPPMRRHPERFDGSSAGLVGLRREVESKRWEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.4
3 0.45
4 0.51
5 0.6
6 0.66
7 0.66
8 0.65
9 0.58
10 0.53
11 0.48
12 0.43
13 0.39
14 0.36
15 0.35
16 0.34
17 0.31
18 0.28
19 0.31
20 0.36
21 0.37
22 0.38
23 0.46
24 0.48
25 0.49
26 0.5
27 0.48
28 0.41
29 0.38
30 0.3
31 0.26
32 0.23
33 0.21
34 0.19
35 0.19
36 0.18
37 0.14
38 0.13
39 0.12
40 0.09
41 0.11
42 0.11
43 0.12
44 0.12
45 0.19
46 0.22
47 0.2
48 0.21
49 0.21
50 0.24
51 0.26
52 0.27
53 0.24
54 0.27
55 0.32
56 0.34
57 0.36
58 0.36
59 0.38
60 0.44
61 0.47
62 0.51
63 0.53
64 0.56
65 0.6
66 0.64
67 0.7
68 0.71
69 0.73
70 0.74
71 0.74
72 0.71
73 0.66
74 0.65
75 0.59
76 0.51
77 0.47
78 0.35
79 0.27
80 0.23
81 0.21
82 0.17
83 0.14
84 0.13
85 0.09
86 0.12
87 0.12
88 0.13
89 0.13
90 0.13
91 0.13
92 0.14
93 0.2
94 0.24
95 0.28
96 0.31
97 0.33
98 0.37
99 0.41
100 0.4
101 0.35
102 0.33
103 0.32
104 0.32
105 0.28
106 0.23
107 0.19
108 0.23
109 0.28
110 0.23
111 0.22
112 0.2
113 0.22
114 0.22
115 0.25
116 0.26
117 0.24
118 0.3
119 0.35
120 0.4
121 0.46
122 0.56
123 0.64
124 0.68
125 0.69
126 0.71
127 0.74
128 0.78
129 0.8
130 0.78
131 0.76
132 0.76
133 0.77
134 0.75
135 0.75
136 0.73
137 0.66
138 0.62
139 0.55
140 0.47
141 0.42
142 0.35
143 0.26
144 0.21
145 0.17
146 0.14
147 0.13
148 0.13
149 0.12
150 0.15
151 0.17
152 0.23