Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RS91

Protein Details
Accession F4RS91    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
105-128NVEFVSKKPLKRQKKDNPDSDLGRHydrophilic
NLS Segment(s)
PositionSequence
52-55KKRK
78-98KKKSGSSQATARRKKKKIAKG
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
KEGG mlr:MELLADRAFT_108182  -  
Amino Acid Sequences MSSQPHTSHANGSDTPPIRNRKQPNCAGMVSPSPDSRWQIRFSVEPTEQTKKKRKAPSATDPAKELEDKSDVSVSISKKKSGSSQATARRKKKKIAKGSEEADSNVEFVSKKPLKRQKKDNPDSDLGRLRAYYNDPIYKRGDVRFIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.43
5 0.43
6 0.51
7 0.59
8 0.6
9 0.68
10 0.72
11 0.7
12 0.67
13 0.63
14 0.55
15 0.48
16 0.42
17 0.35
18 0.3
19 0.25
20 0.22
21 0.24
22 0.26
23 0.29
24 0.29
25 0.29
26 0.28
27 0.3
28 0.31
29 0.29
30 0.33
31 0.28
32 0.3
33 0.32
34 0.38
35 0.39
36 0.45
37 0.53
38 0.54
39 0.62
40 0.66
41 0.7
42 0.71
43 0.76
44 0.78
45 0.78
46 0.76
47 0.68
48 0.61
49 0.53
50 0.45
51 0.37
52 0.27
53 0.18
54 0.14
55 0.13
56 0.12
57 0.12
58 0.1
59 0.11
60 0.14
61 0.14
62 0.2
63 0.21
64 0.21
65 0.22
66 0.23
67 0.26
68 0.3
69 0.34
70 0.31
71 0.38
72 0.47
73 0.56
74 0.64
75 0.69
76 0.71
77 0.7
78 0.74
79 0.75
80 0.75
81 0.76
82 0.78
83 0.77
84 0.74
85 0.73
86 0.68
87 0.6
88 0.5
89 0.41
90 0.31
91 0.23
92 0.15
93 0.13
94 0.09
95 0.08
96 0.18
97 0.21
98 0.23
99 0.33
100 0.44
101 0.54
102 0.63
103 0.74
104 0.75
105 0.82
106 0.89
107 0.87
108 0.85
109 0.81
110 0.76
111 0.71
112 0.67
113 0.57
114 0.49
115 0.41
116 0.34
117 0.31
118 0.31
119 0.32
120 0.31
121 0.38
122 0.38
123 0.41
124 0.44
125 0.46
126 0.46
127 0.42