Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9NX08

Protein Details
Accession R9NX08    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGPSVKKAFRKKQLPKFCTSKVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.333, cyto_nucl 2.333
Family & Domain DBs
Amino Acid Sequences MGPSVKKAFRKKQLPKFCTSKVTFVASGELAEKTMKCRKTNTISESFSPSPTSEHPLFASFLDFIARCVRANVISDKPIVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.81
4 0.75
5 0.74
6 0.66
7 0.6
8 0.52
9 0.5
10 0.43
11 0.35
12 0.32
13 0.23
14 0.21
15 0.16
16 0.13
17 0.09
18 0.09
19 0.09
20 0.12
21 0.18
22 0.22
23 0.22
24 0.25
25 0.32
26 0.38
27 0.45
28 0.46
29 0.47
30 0.46
31 0.46
32 0.49
33 0.43
34 0.36
35 0.31
36 0.25
37 0.2
38 0.19
39 0.24
40 0.18
41 0.19
42 0.19
43 0.2
44 0.2
45 0.18
46 0.18
47 0.12
48 0.11
49 0.12
50 0.11
51 0.11
52 0.14
53 0.15
54 0.14
55 0.15
56 0.17
57 0.16
58 0.2
59 0.25
60 0.25
61 0.27