Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AHG4

Protein Details
Accession R9AHG4   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-34VNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG wic:J056_003869  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRRTYCKGKQCRKHTPHKVTQYKKGKDSIYAQGKRRYDRKQSGFGGQTKPIFHKKAKTTKKVVLRLECSACKYKMQLSLKRTKHFELGGEKKQKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.84
3 0.86
4 0.91
5 0.89
6 0.9
7 0.9
8 0.89
9 0.88
10 0.89
11 0.89
12 0.85
13 0.87
14 0.86
15 0.81
16 0.75
17 0.71
18 0.61
19 0.56
20 0.54
21 0.53
22 0.53
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.58
30 0.57
31 0.6
32 0.61
33 0.61
34 0.6
35 0.61
36 0.58
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.28
46 0.33
47 0.38
48 0.47
49 0.55
50 0.6
51 0.61
52 0.64
53 0.71
54 0.72
55 0.7
56 0.67
57 0.62
58 0.59
59 0.57
60 0.52
61 0.48
62 0.45
63 0.39
64 0.33
65 0.31
66 0.3
67 0.35
68 0.41
69 0.44
70 0.47
71 0.56
72 0.62
73 0.67
74 0.67
75 0.6
76 0.58
77 0.52
78 0.5
79 0.51
80 0.52
81 0.55
82 0.59
83 0.57
84 0.53
85 0.53
86 0.48