Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4RPY2

Protein Details
Accession F4RPY2   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
280-309APPCKEVKSAQKASRPKKNAKAKAMEVKENHydrophilic
NLS Segment(s)
PositionSequence
289-303AQKASRPKKNAKAKA
319-334KKVKVKATARAKGRKK
Subcellular Location(s) nucl 13, cyto_nucl 11.833, cyto 9.5, mito_nucl 7.833
Family & Domain DBs
KEGG mlr:MELLADRAFT_107477  -  
Amino Acid Sequences MNVYFHLCGVAGLSEESRIEFTGEMDGLATLILHDVEYKIVSRGFWQYHHYWCKIVKYLDGVRGVWFFDDHKDNGPAQLLGQDLSLISGMQASTSWLIYSCKPSAVKQKVIDSGISKIPAKNPDAQGDLPFISAQDLEGEEDQLDEAFPDIKGILETVQEESPRTHTSVPVHKAKDAFSSAIPPEDKPPKAESLTTVPTLGPHPPSQGEKAKEAFNRVSFSSSAPVKKTRVDVEDSVQVPATLPNKPKPQSAEALKGPLSVCLRINKRQAESSPVKSPSAPPCKEVKSAQKASRPKKNAKAKAMEVKENLPVPVEDVDKKVKVKATARAKGRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.11
4 0.11
5 0.11
6 0.11
7 0.1
8 0.11
9 0.13
10 0.13
11 0.12
12 0.11
13 0.1
14 0.09
15 0.09
16 0.08
17 0.04
18 0.04
19 0.04
20 0.04
21 0.05
22 0.05
23 0.07
24 0.08
25 0.09
26 0.1
27 0.11
28 0.11
29 0.14
30 0.2
31 0.22
32 0.23
33 0.28
34 0.31
35 0.4
36 0.47
37 0.45
38 0.43
39 0.44
40 0.47
41 0.48
42 0.45
43 0.38
44 0.38
45 0.42
46 0.43
47 0.43
48 0.37
49 0.33
50 0.32
51 0.3
52 0.23
53 0.18
54 0.14
55 0.15
56 0.19
57 0.18
58 0.21
59 0.24
60 0.24
61 0.24
62 0.25
63 0.2
64 0.16
65 0.17
66 0.14
67 0.11
68 0.1
69 0.09
70 0.07
71 0.07
72 0.07
73 0.05
74 0.04
75 0.05
76 0.04
77 0.04
78 0.04
79 0.05
80 0.06
81 0.06
82 0.06
83 0.07
84 0.09
85 0.1
86 0.15
87 0.15
88 0.18
89 0.2
90 0.24
91 0.33
92 0.38
93 0.43
94 0.42
95 0.46
96 0.46
97 0.46
98 0.44
99 0.35
100 0.32
101 0.27
102 0.26
103 0.22
104 0.19
105 0.22
106 0.25
107 0.26
108 0.29
109 0.29
110 0.3
111 0.32
112 0.31
113 0.28
114 0.26
115 0.23
116 0.17
117 0.15
118 0.12
119 0.09
120 0.08
121 0.07
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.06
130 0.05
131 0.04
132 0.03
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.05
141 0.05
142 0.05
143 0.06
144 0.07
145 0.08
146 0.08
147 0.09
148 0.1
149 0.12
150 0.13
151 0.13
152 0.12
153 0.14
154 0.18
155 0.25
156 0.29
157 0.33
158 0.33
159 0.33
160 0.34
161 0.32
162 0.31
163 0.25
164 0.22
165 0.15
166 0.17
167 0.16
168 0.18
169 0.18
170 0.15
171 0.18
172 0.24
173 0.24
174 0.23
175 0.25
176 0.26
177 0.26
178 0.26
179 0.23
180 0.23
181 0.25
182 0.23
183 0.21
184 0.17
185 0.17
186 0.18
187 0.17
188 0.14
189 0.12
190 0.14
191 0.15
192 0.18
193 0.22
194 0.27
195 0.28
196 0.29
197 0.3
198 0.34
199 0.33
200 0.36
201 0.34
202 0.3
203 0.3
204 0.27
205 0.27
206 0.22
207 0.22
208 0.22
209 0.23
210 0.23
211 0.24
212 0.28
213 0.27
214 0.3
215 0.32
216 0.32
217 0.31
218 0.33
219 0.32
220 0.31
221 0.36
222 0.34
223 0.31
224 0.26
225 0.22
226 0.18
227 0.19
228 0.18
229 0.16
230 0.2
231 0.26
232 0.34
233 0.36
234 0.4
235 0.41
236 0.44
237 0.47
238 0.49
239 0.49
240 0.44
241 0.46
242 0.41
243 0.39
244 0.34
245 0.31
246 0.27
247 0.22
248 0.23
249 0.27
250 0.32
251 0.37
252 0.45
253 0.46
254 0.48
255 0.51
256 0.5
257 0.51
258 0.53
259 0.52
260 0.52
261 0.49
262 0.47
263 0.42
264 0.47
265 0.48
266 0.51
267 0.47
268 0.42
269 0.47
270 0.5
271 0.54
272 0.54
273 0.55
274 0.55
275 0.62
276 0.66
277 0.68
278 0.73
279 0.78
280 0.82
281 0.8
282 0.79
283 0.8
284 0.84
285 0.85
286 0.85
287 0.84
288 0.82
289 0.84
290 0.8
291 0.77
292 0.69
293 0.62
294 0.58
295 0.51
296 0.43
297 0.34
298 0.28
299 0.23
300 0.23
301 0.24
302 0.2
303 0.23
304 0.29
305 0.31
306 0.33
307 0.35
308 0.37
309 0.41
310 0.45
311 0.51
312 0.56
313 0.6
314 0.68