Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9AGR4

Protein Details
Accession R9AGR4    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MKLFNKFNKKRSNKKTKKGISNTDIIHydrophilic
NLS Segment(s)
PositionSequence
9-18KKRSNKKTKK
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 6
Family & Domain DBs
KEGG wic:J056_004153  -  
Amino Acid Sequences MKLFNKFNKKRSNKKTKKGISNTDIIPHLSPKQERRQVQYKNNHLKNPIYKLPSIDDISLPDLSDKGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.92
3 0.91
4 0.92
5 0.9
6 0.88
7 0.8
8 0.75
9 0.66
10 0.58
11 0.49
12 0.4
13 0.31
14 0.24
15 0.21
16 0.19
17 0.22
18 0.24
19 0.32
20 0.39
21 0.41
22 0.45
23 0.52
24 0.57
25 0.62
26 0.67
27 0.68
28 0.71
29 0.74
30 0.71
31 0.65
32 0.63
33 0.6
34 0.58
35 0.54
36 0.47
37 0.43
38 0.42
39 0.42
40 0.41
41 0.36
42 0.3
43 0.25
44 0.23
45 0.25
46 0.23
47 0.2
48 0.15
49 0.13