Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9ARU5

Protein Details
Accession R9ARU5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-30YIFNKHSRCVHRQKWEHNRQPAKEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, cyto_mito 10.833, mito_nucl 10.833, nucl 6.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007233  TRAPPC  
Gene Ontology GO:0030008  C:TRAPP complex  
GO:0016192  P:vesicle-mediated transport  
KEGG wic:J056_000269  -  
Pfam View protein in Pfam  
PF04099  Sybindin  
Amino Acid Sequences MVVYALYIFNKHSRCVHRQKWEHNRQPAKELSEEEEEKLIYGVVFSLKGLVKKVAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.51
3 0.58
4 0.62
5 0.69
6 0.77
7 0.81
8 0.85
9 0.85
10 0.84
11 0.83
12 0.74
13 0.71
14 0.64
15 0.55
16 0.46
17 0.39
18 0.32
19 0.3
20 0.29
21 0.25
22 0.22
23 0.19
24 0.17
25 0.16
26 0.12
27 0.06
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.09
34 0.11
35 0.13
36 0.15
37 0.17