Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

R9ARY6

Protein Details
Accession R9ARY6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
23-45QDEHARAQSKRKEDERRRAQDEIBasic
NLS Segment(s)
PositionSequence
30-51QSKRKEDERRRAQDEISKRRKT
Subcellular Location(s) nucl 23, cyto_nucl 15.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
KEGG wic:J056_000133  -  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MAKANSERGAQHLEDMKRHKEEQDEHARAQSKRKEDERRRAQDEISKRRKTTELRNKEVEADRLNQRKKARSMQSHSQNVTSSLASRNRASSSDKSTKPAKQQEVLTREEKRNIKQKKDFGEYGARQKSKSQQKPHQDNYQSGGLIALNTKKRDTRTIEEIQHDLKSKKSIDNGHSKSDTRQSISKRKAPSLPDLSKRKTASKDSKNDIDSDDSISNDVDSDGGDGYNSHDIWSLFGKDKAKYLERDYDSNESDADMEATNEDVIDEELSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.45
3 0.48
4 0.48
5 0.49
6 0.47
7 0.48
8 0.5
9 0.53
10 0.58
11 0.57
12 0.53
13 0.57
14 0.6
15 0.54
16 0.58
17 0.55
18 0.51
19 0.55
20 0.63
21 0.68
22 0.71
23 0.81
24 0.82
25 0.84
26 0.83
27 0.77
28 0.71
29 0.69
30 0.69
31 0.69
32 0.68
33 0.65
34 0.6
35 0.61
36 0.65
37 0.63
38 0.64
39 0.64
40 0.64
41 0.64
42 0.69
43 0.66
44 0.66
45 0.63
46 0.56
47 0.48
48 0.43
49 0.44
50 0.48
51 0.5
52 0.49
53 0.51
54 0.54
55 0.57
56 0.62
57 0.63
58 0.64
59 0.69
60 0.73
61 0.77
62 0.77
63 0.72
64 0.64
65 0.55
66 0.47
67 0.4
68 0.31
69 0.22
70 0.2
71 0.23
72 0.23
73 0.24
74 0.24
75 0.23
76 0.25
77 0.29
78 0.28
79 0.33
80 0.39
81 0.39
82 0.41
83 0.45
84 0.48
85 0.52
86 0.56
87 0.52
88 0.48
89 0.52
90 0.56
91 0.55
92 0.54
93 0.5
94 0.46
95 0.44
96 0.46
97 0.44
98 0.42
99 0.47
100 0.5
101 0.54
102 0.57
103 0.61
104 0.61
105 0.63
106 0.59
107 0.52
108 0.55
109 0.48
110 0.5
111 0.51
112 0.44
113 0.39
114 0.4
115 0.45
116 0.47
117 0.52
118 0.53
119 0.54
120 0.64
121 0.73
122 0.76
123 0.76
124 0.68
125 0.61
126 0.55
127 0.49
128 0.38
129 0.28
130 0.23
131 0.14
132 0.12
133 0.11
134 0.12
135 0.12
136 0.13
137 0.15
138 0.17
139 0.19
140 0.26
141 0.31
142 0.32
143 0.36
144 0.42
145 0.45
146 0.45
147 0.45
148 0.4
149 0.36
150 0.34
151 0.27
152 0.22
153 0.22
154 0.22
155 0.23
156 0.27
157 0.31
158 0.34
159 0.44
160 0.45
161 0.47
162 0.48
163 0.45
164 0.43
165 0.44
166 0.41
167 0.33
168 0.36
169 0.38
170 0.45
171 0.51
172 0.55
173 0.52
174 0.54
175 0.56
176 0.55
177 0.56
178 0.56
179 0.56
180 0.59
181 0.63
182 0.62
183 0.63
184 0.62
185 0.59
186 0.55
187 0.58
188 0.6
189 0.62
190 0.66
191 0.66
192 0.7
193 0.65
194 0.61
195 0.53
196 0.47
197 0.38
198 0.34
199 0.28
200 0.21
201 0.2
202 0.19
203 0.16
204 0.12
205 0.11
206 0.06
207 0.05
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.08
214 0.12
215 0.11
216 0.11
217 0.13
218 0.13
219 0.15
220 0.19
221 0.2
222 0.19
223 0.23
224 0.26
225 0.25
226 0.3
227 0.35
228 0.37
229 0.39
230 0.42
231 0.48
232 0.48
233 0.51
234 0.52
235 0.52
236 0.48
237 0.44
238 0.38
239 0.29
240 0.26
241 0.22
242 0.18
243 0.11
244 0.1
245 0.09
246 0.1
247 0.09
248 0.08
249 0.07
250 0.07
251 0.07