Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AR84

Protein Details
Accession R9AR84    Localization Confidence High Confidence Score 21.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPHKRAKRSVREKNTKDTGFBasic
45-70GQIQADYRDKKNKRKRDADDANEKEKBasic
NLS Segment(s)
PositionSequence
54-61KKNKRKRD
120-142DAKRKEKAEKKAKTKSDKLEKKR
Subcellular Location(s) nucl 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR026680  CCDC137  
KEGG wic:J056_000026  -  
Amino Acid Sequences MPHKRAKRSVREKNTKDTGFNNAPSGYRIDREELPKGAMRILMGGQIQADYRDKKNKRKRDADDANEKEKADLKIRPEERLKDYNRRIDNKMRKDINSTIKSHSSEKTAKQMNKKMQDEDAKRKEKAEKKAKTKSDKLEKKREEETVTAAGSQSDSDGETIQPPRDFAGAERVRLNDVAQAPPSLPRMNRQAKRFGVEDSNAGSRVGTPLMRQLELEKERARVISLYRAQKGKRLENWVSSKEEAEAQVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.79
3 0.72
4 0.64
5 0.62
6 0.57
7 0.54
8 0.47
9 0.39
10 0.36
11 0.33
12 0.35
13 0.28
14 0.24
15 0.24
16 0.24
17 0.28
18 0.33
19 0.36
20 0.33
21 0.34
22 0.34
23 0.33
24 0.3
25 0.26
26 0.21
27 0.17
28 0.16
29 0.16
30 0.13
31 0.12
32 0.11
33 0.11
34 0.11
35 0.11
36 0.16
37 0.16
38 0.22
39 0.32
40 0.39
41 0.5
42 0.6
43 0.68
44 0.74
45 0.81
46 0.82
47 0.83
48 0.87
49 0.84
50 0.85
51 0.8
52 0.75
53 0.67
54 0.6
55 0.49
56 0.44
57 0.38
58 0.31
59 0.29
60 0.28
61 0.36
62 0.37
63 0.42
64 0.42
65 0.45
66 0.47
67 0.52
68 0.53
69 0.54
70 0.59
71 0.61
72 0.63
73 0.63
74 0.62
75 0.64
76 0.69
77 0.67
78 0.69
79 0.65
80 0.59
81 0.59
82 0.61
83 0.61
84 0.56
85 0.5
86 0.44
87 0.44
88 0.45
89 0.42
90 0.36
91 0.32
92 0.31
93 0.31
94 0.35
95 0.38
96 0.41
97 0.46
98 0.52
99 0.54
100 0.59
101 0.59
102 0.53
103 0.52
104 0.55
105 0.54
106 0.56
107 0.57
108 0.53
109 0.51
110 0.52
111 0.55
112 0.53
113 0.57
114 0.58
115 0.57
116 0.62
117 0.71
118 0.76
119 0.75
120 0.75
121 0.74
122 0.74
123 0.75
124 0.74
125 0.76
126 0.73
127 0.69
128 0.66
129 0.61
130 0.53
131 0.45
132 0.4
133 0.32
134 0.27
135 0.23
136 0.19
137 0.15
138 0.12
139 0.1
140 0.07
141 0.05
142 0.05
143 0.05
144 0.05
145 0.06
146 0.09
147 0.11
148 0.13
149 0.13
150 0.13
151 0.13
152 0.14
153 0.13
154 0.11
155 0.2
156 0.2
157 0.21
158 0.23
159 0.23
160 0.23
161 0.23
162 0.23
163 0.17
164 0.17
165 0.17
166 0.16
167 0.16
168 0.15
169 0.17
170 0.2
171 0.19
172 0.17
173 0.2
174 0.29
175 0.39
176 0.45
177 0.47
178 0.53
179 0.53
180 0.56
181 0.53
182 0.46
183 0.42
184 0.37
185 0.35
186 0.29
187 0.28
188 0.25
189 0.23
190 0.2
191 0.14
192 0.15
193 0.15
194 0.12
195 0.1
196 0.17
197 0.2
198 0.2
199 0.2
200 0.21
201 0.28
202 0.31
203 0.36
204 0.32
205 0.31
206 0.32
207 0.32
208 0.32
209 0.25
210 0.25
211 0.29
212 0.34
213 0.4
214 0.43
215 0.49
216 0.49
217 0.53
218 0.58
219 0.57
220 0.57
221 0.59
222 0.59
223 0.62
224 0.69
225 0.67
226 0.64
227 0.56
228 0.5
229 0.42
230 0.4