Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

R9AK57

Protein Details
Accession R9AK57   
Localization Confidence High
Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGKRKAARKPTGPKKDKTTLPBasic
79-100DEVNFPQQKKKRVEDRPPASDEHydrophilic
NLS Segment(s)
PositionSequence
3-16KRKAARKPTGPKKD
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
KEGG wic:J056_000969  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAARKPTGPKKDKTTLPKTFECLFCSRNDAVQVKLDQKNGMGYLNCKVCNMRFESTINSLTAPVDLYHDWIDANDEVNFPQQKKKRVEDRPPASDEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.79
4 0.78
5 0.77
6 0.75
7 0.74
8 0.7
9 0.66
10 0.63
11 0.57
12 0.51
13 0.45
14 0.37
15 0.32
16 0.34
17 0.29
18 0.26
19 0.29
20 0.26
21 0.23
22 0.25
23 0.27
24 0.28
25 0.3
26 0.3
27 0.25
28 0.23
29 0.23
30 0.2
31 0.19
32 0.13
33 0.11
34 0.14
35 0.17
36 0.16
37 0.15
38 0.16
39 0.15
40 0.17
41 0.2
42 0.18
43 0.17
44 0.18
45 0.21
46 0.24
47 0.24
48 0.21
49 0.17
50 0.16
51 0.14
52 0.13
53 0.1
54 0.07
55 0.08
56 0.08
57 0.1
58 0.1
59 0.1
60 0.1
61 0.1
62 0.12
63 0.1
64 0.12
65 0.1
66 0.1
67 0.1
68 0.17
69 0.2
70 0.19
71 0.28
72 0.33
73 0.41
74 0.48
75 0.57
76 0.62
77 0.69
78 0.79
79 0.81
80 0.83
81 0.82
82 0.79